Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06696
Gene name
Locationscaffold_08:831747..832861
Strand-
Gene length (bp)1114
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1708 0.9703 0.1056 0.0135 0.075 0.0005 0.0181 0.0097 0.012 0.0008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup264
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4823
Ophiocordyceps australis 1348a (Ghana) OphauG2|4824
Ophiocordyceps australis map64 (Brazil) OphauB2|3299
Ophiocordyceps australis map64 (Brazil) OphauB2|3300
Ophiocordyceps camponoti-floridani Ophcf2|06695
Ophiocordyceps camponoti-floridani Ophcf2|06696 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6321
Ophiocordyceps kimflemingae Ophio5|1555
Ophiocordyceps kimflemingae Ophio5|1556
Ophiocordyceps subramaniannii Hirsu2|10758
Ophiocordyceps subramaniannii Hirsu2|10759

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06696
MSSKNWNDRADKDLFFTILSVKNIGVISGAEWTTIGNHMRTLGYGFTNEGCRQHFQGLRRAQNKADANGVVVDTA
SPRRVDPTLNPITRRPGPGRGRPRKQSHQDLSQQSSPVQPNTAVPPTVMPQGAVPVAVSVPVPVPVQYTGAIPGP
YYGAVPANMTAATMGQPRRSQEPPSHGPDKATTADGSQRPSVEAACDSPRPALLPTDPPPVDHGEEADVDAEGAE
SAGPMEAAEQMEGHDEPPLKRQKMEPHDAESESLGDEAVLALAAHNGSTGPDPYGSDFDYHGEA*
Coding >Ophcf2|06696
ATGAGCTCCAAGAACTGGAATGACCGCGCCGACAAAGACCTGTTCTTCACCATCCTGTCCGTCAAGAATATTGGC
GTCATCAGCGGAGCTGAATGGACAACCATAGGCAACCATATGCGCACCCTCGGCTATGGCTTCACCAATGAGGGA
TGCCGCCAGCACTTCCAGGGACTGAGGCGCGCTCAGAACAAGGCTGACGCCAACGGTGTCGTCGTCGATACCGCC
TCGCCGCGACGTGTCGATCCTACTCTCAATCCCATCACCAGGAGGCCGGGACCGGGACGAGGTCGTCCGAGGAAG
CAGTCGCATCAGGATCTGTCGCAGCAATCGTCTCCTGTCCAGCCGAATACTGCCGTTCCCCCCACCGTCATGCCA
CAGGGCGCCGTACCGGTCGCCGTCTCCGTCCCCGTCCCCGTCCCCGTTCAATATACCGGCGCCATACCCGGCCCG
TATTACGGCGCCGTCCCAGCCAACATGACGGCCGCGACCATGGGCCAGCCGCGACGGAGTCAGGAGCCGCCTTCG
CATGGGCCCGACAAGGCGACTACGGCCGACGGCTCGCAGCGGCCTTCGGTGGAGGCGGCTTGCGACTCGCCCCGA
CCCGCCTTGCTACCGACAGATCCGCCGCCGGTCGATCATGGCGAAGAGGCCGACGTTGACGCCGAAGGGGCCGAG
AGTGCCGGTCCCATGGAGGCGGCCGAGCAGATGGAAGGCCACGACGAGCCTCCGCTCAAACGGCAGAAGATGGAG
CCGCACGACGCCGAAAGCGAGTCTCTCGGCGACGAGGCGGTGCTGGCTCTGGCAGCCCATAACGGATCGACGGGT
CCAGACCCGTACGGGTCAGACTTCGACTATCACGGCGAAGCGTGA
Transcript >Ophcf2|06696
ATGAGCTCCAAGAACTGGAATGACCGCGCCGACAAAGACCTGTTCTTCACCATCCTGTCCGTCAAGAATATTGGC
GTCATCAGCGGAGCTGAATGGACAACCATAGGCAACCATATGCGCACCCTCGGCTATGGCTTCACCAATGAGGGA
TGCCGCCAGCACTTCCAGGGACTGAGGCGCGCTCAGAACAAGGCTGACGCCAACGGTGTCGTCGTCGATACCGCC
TCGCCGCGACGTGTCGATCCTACTCTCAATCCCATCACCAGGAGGCCGGGACCGGGACGAGGTCGTCCGAGGAAG
CAGTCGCATCAGGATCTGTCGCAGCAATCGTCTCCTGTCCAGCCGAATACTGCCGTTCCCCCCACCGTCATGCCA
CAGGGCGCCGTACCGGTCGCCGTCTCCGTCCCCGTCCCCGTCCCCGTTCAATATACCGGCGCCATACCCGGCCCG
TATTACGGCGCCGTCCCAGCCAACATGACGGCCGCGACCATGGGCCAGCCGCGACGGAGTCAGGAGCCGCCTTCG
CATGGGCCCGACAAGGCGACTACGGCCGACGGCTCGCAGCGGCCTTCGGTGGAGGCGGCTTGCGACTCGCCCCGA
CCCGCCTTGCTACCGACAGATCCGCCGCCGGTCGATCATGGCGAAGAGGCCGACGTTGACGCCGAAGGGGCCGAG
AGTGCCGGTCCCATGGAGGCGGCCGAGCAGATGGAAGGCCACGACGAGCCTCCGCTCAAACGGCAGAAGATGGAG
CCGCACGACGCCGAAAGCGAGTCTCTCGGCGACGAGGCGGTGCTGGCTCTGGCAGCCCATAACGGATCGACGGGT
CCAGACCCGTACGGGTCAGACTTCGACTATCACGGCGAAGCGTGA
Gene >Ophcf2|06696
ATGAGCTCCAAGAACTGGAATGACCGCGCCGACAAAGACCTGTTCTTCACCATCCTGTCCGTCAAGAATATTGGC
GTCATCAGCGGAGCTGAATGGACAACCATAGGCAACCATATGCGCACCCTCGGCTATGGCTTCACCAATGAGGGA
TGCCGGTGAGTTCCTCCTGAGCTCGTTCAGTTCGGAAAGCTGATTGTTCGTCTTTTTTTCTTTGTCCTCTTGTTG
TCTTCCCACCAGCCAGCACTTCCAGGGACTGAGGCGCGCTCAGAACAAGGCTGACGCCAACGGTGTCGTCGTCGA
TACCGCCTCGCCGCGACGTGTCGATCCTACTCTCAATCCCATCACCAGGAGGCCGGGACCGGGACGAGGTCGTCC
GAGGAAGCAGTCGCATCAGGATCTGTCGCAGCAATCGTCTCCTGTCCAGCCGAATACTGCCGTTCCCCCCACCGT
CATGCCACAGGGCGCCGTACCGGTCGCCGTCTCCGTCCCCGTCCCCGTCCCCGTTCAATATACCGGCGCCATACC
CGGCCCGTATTACGGCGCCGTCCCAGCCAACATGACGGCCGCGACCATGGGCCAGCCGCGACGGAGTCAGGAGCC
GCCTTCGCATGGGCCCGACAAGGCGACTACGGCCGACGGCTCGCAGCGGCCTTCGGTGGAGGCGGCTTGCGACTC
GCCCCGACCCGCCTTGCTACCGACAGATCCGCCGCCGGTCGATCATGGCGAAGAGGCCGACGTTGACGCCGAAGG
GGCCGAGAGTGCCGGTCCCATGGAGGCGGCCGAGCAGATGGAAGGCCACGACGAGCCTCCGCTCAAACGGCAGAA
GATGGAGCCGCACGACGCCGAAAGCGAGTCTCTCGGCGACGAGGCGGTGCTGGCTCTGGCAGCCCATAACGGATC
GACGGGTCCAGACCCGTACGGGTCAGAGTATGTCTCCCCTTTGCCGCCTTCTGGGTTGTGGTGAAGAAGAGGAAG
AAGAAGAGCCGAGGAAGAAGAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAGAAGAAGAAGAAGAGCAAGAAGAGT
AGAAGATGATTAAGGGAGGTGCTAAGAAGTCGACGCCAGCTTCGACTATCACGGCGAAGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail