Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06693
Gene name
Locationscaffold_08:823151..826977
Strand-
Gene length (bp)3826
Transcript length (bp)2394
Coding sequence length (bp)2394
Protein length (aa) 798

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain 1.0E-68 616 773
PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain 5.6E-36 465 563

GO

GO Term Description Terminal node
GO:0051287 NAD binding Yes
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor Yes
GO:0000166 nucleotide binding No
GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3947 0.7608 0.1685 0.0514 0.1679 0.0492 0.1467 0.0479 0.0348 0.0395

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1349
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4828
Ophiocordyceps australis map64 (Brazil) OphauB2|3294
Ophiocordyceps camponoti-floridani Ophcf2|06693 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6317
Ophiocordyceps kimflemingae Ophio5|4177
Ophiocordyceps subramaniannii Hirsu2|10752

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06693
MIQSSNKKRQLWIVSLGGYSRMTHTVVLSAPDKPLPWCQFTSTSHYGFLVLVTSLILSPLPIPSSNTTAMASRYS
AARPKRAGENFARTHHHDRNDEGDSKRVKFDVRNPSTLAPDAREDDDVLDADVIGGTSATKRGAVNLDGYDSDSD
NDKLETKAAARRSDQVDLLKQMDNYDASGDTVENKDDDDDDMFAADTETAGPDGSKKPQNKQVSFMEYSQIEGQE
DTSRSGGRVRLDEQESSDDEADVELAIQEEGVDEEVGAGGLKRNAPKIEAFNMREEMERGRFDQNENYIRNADDP
DALHDGWLEGCSKKDMKKAAEAHEKREAEARTKRIQDDGVLVADLLRALISQLERTESALEALARLGKSQTKSKK
VPKWKQKKANKGAECMDVDAEAGEHDAKQARIKASIDAITEAADKLLSRDFEDIYDQERELLLSAISIRIHRHPI
LPLCTIHTHPAADVVGINGFGRIGRIVFRNAIEHPDIEVVAVNDPFIETEYAAYMLKYDSSHGPFKGDIAVSGDH
LSVNGKKVKFYNKREPGEIPWNETGAEYIVESTGVFTTTEKAKAHLKGGAKKVVISAPSADAPMYVMGVNEKTYD
GSADVISNASCTTNCLAPLAKVIHDKFTIIEGLMTTVHSYTATQKTVDGPSAKDWRGGRGAAQNIIPSSTGAAKA
VGKVIPDLNGKLTGMSMRVPTANVSVVDLTVRLGKSATYDQIKEAIQEAAKGPLKGILAYCDEEIVSSDLNGNTN
SSIFDAKAGISLNPNFAKLISWYDNEWGYSRRVLDLLAYISKVDAGK*
Coding >Ophcf2|06693
ATGATTCAGAGTTCGAATAAGAAGAGGCAGCTTTGGATTGTGTCTTTAGGAGGCTACAGCCGCATGACGCATACT
GTCGTCTTATCGGCGCCCGATAAGCCCTTGCCCTGGTGTCAGTTCACCTCGACGAGCCATTACGGCTTCTTAGTT
CTAGTAACCTCTCTCATCCTGTCCCCTCTTCCTATCCCATCCTCCAACACTACCGCAATGGCCTCACGATACTCG
GCGGCGCGTCCCAAGCGGGCTGGCGAGAACTTTGCGCGGACCCATCACCACGACCGCAACGACGAGGGAGACAGT
AAGAGAGTCAAGTTTGATGTGCGGAATCCATCGACGCTTGCGCCAGATGCTCGCGAGGACGACGATGTGCTCGAT
GCCGATGTTATTGGTGGCACCAGCGCTACTAAGCGAGGTGCCGTCAACCTCGATGGCTATGACAGCGATTCGGAC
AACGACAAGCTCGAGACCAAAGCTGCAGCACGTAGGAGCGACCAAGTCGATCTGCTGAAACAAATGGACAACTAC
GATGCTAGCGGTGATACTGTTGAGAATAAAGACGATGACGACGATGACATGTTCGCCGCAGACACAGAGACTGCA
GGCCCCGACGGCTCCAAGAAACCTCAAAACAAGCAGGTCAGCTTTATGGAGTACTCGCAGATCGAAGGCCAAGAA
GATACGAGCAGAAGTGGCGGCCGGGTCCGGCTAGACGAGCAGGAGAGCAGCGACGACGAGGCCGACGTCGAGCTG
GCGATCCAGGAAGAGGGGGTCGACGAGGAAGTCGGTGCTGGAGGTCTAAAGCGCAACGCGCCCAAGATTGAAGCA
TTCAATATGAGGGAAGAGATGGAACGAGGTCGTTTCGATCAAAACGAAAACTACATTCGCAATGCTGACGACCCG
GATGCTTTGCACGACGGTTGGCTCGAGGGCTGCAGCAAGAAAGATATGAAGAAGGCGGCCGAGGCGCACGAGAAG
CGTGAGGCCGAGGCTCGCACCAAGCGCATACAGGACGACGGCGTCTTGGTTGCAGACCTGCTCCGGGCGCTCATC
TCGCAGCTAGAGAGGACAGAGTCCGCGCTCGAGGCTCTGGCCCGGCTAGGCAAGAGTCAGACCAAGAGCAAGAAG
GTGCCCAAGTGGAAACAGAAGAAGGCGAACAAGGGCGCAGAGTGCATGGACGTCGACGCCGAGGCGGGCGAGCAC
GACGCGAAGCAGGCCAGGATCAAGGCGTCCATCGACGCCATCACCGAGGCGGCCGACAAGCTCCTCAGCCGGGAC
TTTGAGGATATTTACGATCAAGAGAGGGAGTTACTCCTCTCTGCCATCTCCATACGAATACATCGTCACCCTATT
CTCCCTCTCTGCACCATTCACACCCATCCAGCAGCAGACGTCGTTGGCATCAACGGCTTCGGCCGCATCGGTCGT
ATCGTCTTCCGTAACGCCATCGAGCATCCCGACATCGAGGTTGTCGCCGTCAACGACCCCTTCATTGAGACGGAA
TATGCTGCCTACATGCTCAAATATGACTCCTCCCACGGCCCCTTCAAGGGCGACATTGCCGTCTCTGGCGACCAC
CTCTCCGTCAATGGCAAAAAGGTCAAGTTCTACAACAAGCGCGAACCCGGGGAGATACCCTGGAATGAGACGGGC
GCCGAGTACATTGTCGAGTCTACCGGCGTCTTCACCACGACGGAAAAGGCCAAGGCTCATCTCAAGGGCGGCGCC
AAAAAGGTGGTCATCTCGGCCCCTTCGGCCGACGCCCCCATGTATGTCATGGGTGTCAACGAGAAGACGTACGAC
GGCTCGGCCGACGTCATCTCCAACGCCTCGTGCACCACCAATTGCCTGGCTCCGCTGGCCAAGGTGATCCACGAC
AAGTTCACCATCATTGAGGGCCTCATGACGACGGTCCACTCGTACACGGCCACGCAGAAGACGGTCGACGGGCCG
TCGGCCAAGGACTGGCGCGGCGGTCGCGGTGCTGCCCAGAACATCATCCCCAGCAGCACCGGCGCCGCAAAGGCC
GTCGGCAAGGTGATTCCCGACCTCAACGGCAAGCTGACGGGCATGTCTATGCGCGTGCCCACGGCCAACGTGTCA
GTCGTCGACCTGACGGTCCGCCTCGGGAAGAGCGCCACGTACGACCAGATCAAGGAGGCCATCCAAGAGGCCGCC
AAGGGACCCCTCAAGGGCATTCTGGCCTACTGCGACGAGGAGATCGTCTCGTCGGACCTCAACGGCAACACCAAC
TCTTCCATCTTTGACGCCAAGGCTGGCATTTCACTGAATCCCAACTTCGCCAAGCTCATCAGCTGGTACGACAAC
GAGTGGGGCTACTCCCGCCGCGTTCTCGACCTCTTGGCCTACATCTCCAAGGTCGACGCCGGAAAATAA
Transcript >Ophcf2|06693
ATGATTCAGAGTTCGAATAAGAAGAGGCAGCTTTGGATTGTGTCTTTAGGAGGCTACAGCCGCATGACGCATACT
GTCGTCTTATCGGCGCCCGATAAGCCCTTGCCCTGGTGTCAGTTCACCTCGACGAGCCATTACGGCTTCTTAGTT
CTAGTAACCTCTCTCATCCTGTCCCCTCTTCCTATCCCATCCTCCAACACTACCGCAATGGCCTCACGATACTCG
GCGGCGCGTCCCAAGCGGGCTGGCGAGAACTTTGCGCGGACCCATCACCACGACCGCAACGACGAGGGAGACAGT
AAGAGAGTCAAGTTTGATGTGCGGAATCCATCGACGCTTGCGCCAGATGCTCGCGAGGACGACGATGTGCTCGAT
GCCGATGTTATTGGTGGCACCAGCGCTACTAAGCGAGGTGCCGTCAACCTCGATGGCTATGACAGCGATTCGGAC
AACGACAAGCTCGAGACCAAAGCTGCAGCACGTAGGAGCGACCAAGTCGATCTGCTGAAACAAATGGACAACTAC
GATGCTAGCGGTGATACTGTTGAGAATAAAGACGATGACGACGATGACATGTTCGCCGCAGACACAGAGACTGCA
GGCCCCGACGGCTCCAAGAAACCTCAAAACAAGCAGGTCAGCTTTATGGAGTACTCGCAGATCGAAGGCCAAGAA
GATACGAGCAGAAGTGGCGGCCGGGTCCGGCTAGACGAGCAGGAGAGCAGCGACGACGAGGCCGACGTCGAGCTG
GCGATCCAGGAAGAGGGGGTCGACGAGGAAGTCGGTGCTGGAGGTCTAAAGCGCAACGCGCCCAAGATTGAAGCA
TTCAATATGAGGGAAGAGATGGAACGAGGTCGTTTCGATCAAAACGAAAACTACATTCGCAATGCTGACGACCCG
GATGCTTTGCACGACGGTTGGCTCGAGGGCTGCAGCAAGAAAGATATGAAGAAGGCGGCCGAGGCGCACGAGAAG
CGTGAGGCCGAGGCTCGCACCAAGCGCATACAGGACGACGGCGTCTTGGTTGCAGACCTGCTCCGGGCGCTCATC
TCGCAGCTAGAGAGGACAGAGTCCGCGCTCGAGGCTCTGGCCCGGCTAGGCAAGAGTCAGACCAAGAGCAAGAAG
GTGCCCAAGTGGAAACAGAAGAAGGCGAACAAGGGCGCAGAGTGCATGGACGTCGACGCCGAGGCGGGCGAGCAC
GACGCGAAGCAGGCCAGGATCAAGGCGTCCATCGACGCCATCACCGAGGCGGCCGACAAGCTCCTCAGCCGGGAC
TTTGAGGATATTTACGATCAAGAGAGGGAGTTACTCCTCTCTGCCATCTCCATACGAATACATCGTCACCCTATT
CTCCCTCTCTGCACCATTCACACCCATCCAGCAGCAGACGTCGTTGGCATCAACGGCTTCGGCCGCATCGGTCGT
ATCGTCTTCCGTAACGCCATCGAGCATCCCGACATCGAGGTTGTCGCCGTCAACGACCCCTTCATTGAGACGGAA
TATGCTGCCTACATGCTCAAATATGACTCCTCCCACGGCCCCTTCAAGGGCGACATTGCCGTCTCTGGCGACCAC
CTCTCCGTCAATGGCAAAAAGGTCAAGTTCTACAACAAGCGCGAACCCGGGGAGATACCCTGGAATGAGACGGGC
GCCGAGTACATTGTCGAGTCTACCGGCGTCTTCACCACGACGGAAAAGGCCAAGGCTCATCTCAAGGGCGGCGCC
AAAAAGGTGGTCATCTCGGCCCCTTCGGCCGACGCCCCCATGTATGTCATGGGTGTCAACGAGAAGACGTACGAC
GGCTCGGCCGACGTCATCTCCAACGCCTCGTGCACCACCAATTGCCTGGCTCCGCTGGCCAAGGTGATCCACGAC
AAGTTCACCATCATTGAGGGCCTCATGACGACGGTCCACTCGTACACGGCCACGCAGAAGACGGTCGACGGGCCG
TCGGCCAAGGACTGGCGCGGCGGTCGCGGTGCTGCCCAGAACATCATCCCCAGCAGCACCGGCGCCGCAAAGGCC
GTCGGCAAGGTGATTCCCGACCTCAACGGCAAGCTGACGGGCATGTCTATGCGCGTGCCCACGGCCAACGTGTCA
GTCGTCGACCTGACGGTCCGCCTCGGGAAGAGCGCCACGTACGACCAGATCAAGGAGGCCATCCAAGAGGCCGCC
AAGGGACCCCTCAAGGGCATTCTGGCCTACTGCGACGAGGAGATCGTCTCGTCGGACCTCAACGGCAACACCAAC
TCTTCCATCTTTGACGCCAAGGCTGGCATTTCACTGAATCCCAACTTCGCCAAGCTCATCAGCTGGTACGACAAC
GAGTGGGGCTACTCCCGCCGCGTTCTCGACCTCTTGGCCTACATCTCCAAGGTCGACGCCGGAAAATAA
Gene >Ophcf2|06693
ATGATTCAGAGTTCGAATAAGAAGAGGCAGCTTTGGATTGTGTCTTTAGGAGGCTACAGCCGCATGACGCATACT
GTCGTCTTATCGGCGCCCGATAAGCCCTTGCCCTGGGTAAGGCGGCTAGGGCCCAAAGGGTGAGTGGTGGGTTAG
TAAGCGTATCCACTACTATTATGTATGTATGTACATATTACCTAAGTACTACCCAGGTAAGGACTTGTCAAGAAT
ATAGCCCGTGATACTGCCCATCTAGAGTCCGATCTATGTAGGTCGGGAGGTCTCCCTTTTGCCTTTTGCCAATGG
CCTAGACGGACTGTGACAGTATTCGTACCTGTCAGTGTCAGTTCACCTCGACGAGCCATTACGGCTTCTTAGTTC
TAGGTATGTAGGTATCTGCCATTTGCTGTTCGTACAACAGCCTCACCCTGCGGCAGTAACCTCTCTCATCCTGTC
CCCTCTTCCTATCCCATCCTCCAACACTACCGCAATGGCCTCACGATACTCGGCGGCGCGTCCCAAGCGGGCTGG
CGAGAACTTTGCGCGGACCCATCACCACGACCGCAACGACGAGGGAGACAGTAAGAGAGTCAAGTTTGATGTGCG
GAATCCATCGACGCTTGCGCCAGATGCTCGCGAGGACGACGATGTGCTCGATGCCGATGTTATTGGTGGCACCAG
CGCTACTAAGCGAGGTGCCGTCAACCTCGATGGCTATGACAGCGATTCGGACAACGACAAGCTCGAGACCAAAGC
TGCAGCACGTAGGAGCGACCAAGTCGATCTGCTGAAACAAATGGACAACTACGATGCTAGCGGTGATACTGTTGA
GAATAAAGACGATGACGACGATGACATGTTCGCCGCAGACACAGAGACTGCAGGCCCCGACGGCTCCAAGAAACC
TCAAAACAAGCAGGTCAGCTTTATGGAGTACTCGCAGATCGAAGGCCAAGAAGATACGAGCAGAAGTGGCGGCCG
GGTCCGGCTAGACGAGCAGGAGAGCAGCGACGACGAGGCCGACGTCGAGCTGGCGATCCAGGAAGAGGGGGTCGA
CGAGGAAGTCGGTGCTGGAGGTCTAAAGCGCAACGCGCCCAAGATTGAAGCATTCAATATGAGGGAAGAGATGGA
ACGAGGTCGTTTCGATCAAAACGAAAACTACATTCGCAATGCTGACGACCCGGATGCTTTGCACGACGGTTGGCT
CGAGGGCTGCAGCAAGAAAGATATGAAGAAGGCGGCCGAGGCGCACGAGAAGCGTGAGGCCGAGGCTCGCACCAA
GCGCATACAGGACGACGGCGTCTTGGTTGCAGACCTGCTCCGGGCGCTCATCTCGCAGCTAGAGAGGACAGAGTC
CGCGCTCGAGGCTCTGGCCCGGCTAGGCAAGAGTCAGACCAAGAGCAAGAAGGTGCCCAAGTGGAAACAGAAGAA
GGCGAACAAGGGCGCAGAGTGCATGGACGTCGACGCCGAGGCGGGCGAGCACGACGCGAAGCAGGCCAGGATCAA
GGCGTCCATCGACGCCATCACCGAGGCGGCCGACAAGCTCCTCAGCCGGGACTTTGAGGATATTTACGATCAAGA
GAGGGAGTTACTCGTGCGAGAGTACGAGCGGAGAGTGGGCGAACCGTGGGTTGAGCCCGAGCAGGCGGCGGACGG
AGACGAAGAAGCGGAAATGTGGGAGTTTCGCTGGATGGACGGACGCGATGGCGGCGGCACGCAGGGCCCCTTTGA
CGGCGCGACGATGAAGGCCTGGGAAGAGGCGGGCTACTTTGGCCAGGGGGGCGTCGAGTTCCGTCTGGCCGGGGA
CGACGACGGCCGGGGCTGGATGCAGGAGGCGGCCTTCGGGTGAAGCCGGTTGCGATGCCTCGGTTGCGGGCCAGC
GGAAGTTGTTGCGGGCGGTGTCGGCCTGTGTCAGCCTGTGTCAGCAGGTGAGGGATGGTGAGAAGCTTTCAGTCT
CGTCTATGTATGTATGTATGTAATTCCCGTGAGCTCTTTTCCGTTGGATTCCGCGAGTCAGGCGGGCTGGTGGCG
GTTGGAGCTGGTGGAAGAGCTTGAAGCTGTGTGGCTGCTGGGTAAGCGTATGTATATACATAGATACATACATAC
ATACATACATACATACTGCATGATCCCTATCCGTGACAGCTGTAAGAACAGAACAAGCGTGAGACGTGCGCCGTC
TCGTCCCGGAGCTCGTCGCTTTGACTGCGTGTTCGATCGTAGACTCGTACATATGTATTATGTACTCGATGGTTG
GATTGTTCGGTATCACGAATAGCCCCGGACGAGGTACATGCATACTTAGGTAGGTAGGTAGGTATGCGCCAAGAC
TGAGCCGGAGATAGGTGCATATGTACTTACACACATACCTCTGCATACCTATAACCTGCTGTAGCTACCTAACTA
CCTAGCTAGGTCTAGGGTAGCCTCCCCCATCCGGCTGATGAAGGGCTTTCCCCTCCCCCTCCTTCATTTCCTCCG
CCTTCTCTCGTCTTCTCCTCTTTCCCCTCTCCTTCTCTCTCGCCACCGCTTTCGAGCTTCACGAGACTCGTCCTC
AGCTCTCTGCCATCTCCATACGAATACATCGTCACCCTATTCTCCCTCTCTGCACCATTCACACCCATCGTAAGC
TCTCCTTTTTGCCTGCCCCGCACCGCTGACTTCCACCCCGCTGACCCCTCGTTTAACAGCAGCAGCAGACGTCGT
CGTCGACACTCTCCGACTCTCTGAGCTTAAATAATGGCTCCCGTCAAGGTTGGCATCAACGGCTTCGGCCGCATC
GGTCGTATCGTCTTCCGTAACGCCATCGAGCATCCCGACATCGAGGTTGTCGCCGTCAACGACCCCTTCATTGAG
ACGGAATATGCTGTCAGTTTTTTTCTCCTCTACCCCACACCATCCACCCAACGAGATGATACTGACTCTTAGACC
CCCTTCCCCACAGGCCTACATGCTCAAATATGACTCCTCCCACGGCCCCTTCAAGGGCGACATTGCCGTCTCTGG
CGACCACCTCTCCGTCAATGGCAAAAAGGTCAAGTTCTACAACAAGCGCGAACCCGGGGAGATACCCTGGAATGA
GACGGGCGCCGAGTACATTGTCGAGTCTACCGGCGTCTTCACCACGACGGAAAAGGCCAAGGCTCATCTCAAGGG
CGGCGCCAAAAAGGTGGTCATCTCGGCCCCTTCGGCCGACGCCCCCATGTATGTCATGGGTGTCAACGAGAAGAC
GTACGACGGCTCGGCCGACGTCATCTCCAACGCCTCGTGCACCACCAATTGCCTGGCTCCGCTGGCCAAGGTGAT
CCACGACAAGTTCACCATCATTGAGGGCCTCATGACGACGGTCCACTCGTACACGGCCACGCAGAAGACGGTCGA
CGGGCCGTCGGCCAAGGACTGGCGCGGCGGTCGCGGTGCTGCCCAGAACATCATCCCCAGCAGCACCGGCGCCGC
AAAGGCCGTCGGCAAGGTGATTCCCGACCTCAACGGCAAGCTGACGGGCATGTCTATGCGCGTGCCCACGGCCAA
CGTGTCAGTCGTCGACCTGACGGTCCGCCTCGGGAAGAGCGCCACGTACGACCAGATCAAGGAGGCCATCCAAGA
GGCCGCCAAGGGACCCCTCAAGGGCATTCTGGCCTACTGCGACGAGGAGATCGTCTCGTCGGACCTCAACGGCAA
CACCAACTCTTCCATCTTTGACGCCAAGGCTGGCATTTCACTGAATCCCAACTTCGCCAAGCTCATCAGCTGGTA
CGACAACGAGTGGGGCTACTCCCGCCGCGTTCTCGACCTCTTGGCCTACATCTCCAAGGTCGACGCCGGAAAATA
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail