Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06689
Gene name
Locationscaffold_08:810599..812315
Strand+
Gene length (bp)1716
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 3.5E-05 438 488

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005515 protein binding No
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4276 0.8573 0.0862 0.0417 0.2562 0.001 0.0686 0.0228 0.0202 0.0085

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1345
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6952
Ophiocordyceps australis map64 (Brazil) OphauB2|3290
Ophiocordyceps camponoti-floridani Ophcf2|06689 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|90
Ophiocordyceps kimflemingae Ophio5|6065
Ophiocordyceps subramaniannii Hirsu2|10746

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06689
MIAVQLAPSMAPSTGSSPPPDSDSVLPFGYALDPAEEPSFDVPNPAPGTPILSENDTRVICTFFADMTSNHYNTP
SFGEGITLSEAWMNLPPQFMGTATSYGSHDPSLHNQPFTAADQPPHQPRHNHNSSSTSNTTSYHTRYHIRYHTQY
HTRYHTNSTINSPSRSLIHSLINSPINSPINSPTNSPINSPINNPINYIIINNTINYTINIHSITTRPRMTSSTQ
PPPWSRAPLSAASPPPGQASPNFRGCPTLLTMEVDHGPPLVDWMWGSRPVPAARRPTAPVEDFQWGSDASFGPAP
QGYAPEQPAQAAADVVSQTHMRCLDCLQVNPSAANTRTNSPAALGNTVGDVSAYIKREEDHGVPPRKRRKSENFK
EPVDDPDDNQDNDVGKRRRSRTDRLDDASPRAVEATPAPPSRRRKSTANGTKPPRENLTEEQKRENHIRSEQKRR
TLIKEGFDDLCDLVPGLKGGGFSKSTMLSLTAEWLEELIGGNQTLVAQLAGLGNKDEEARS*
Coding >Ophcf2|06689
ATGATCGCCGTGCAACTCGCTCCCAGCATGGCTCCCAGTACGGGTTCGTCGCCGCCGCCAGATTCCGACTCTGTC
CTCCCCTTTGGCTATGCCCTGGACCCGGCCGAGGAGCCGAGCTTCGATGTGCCCAATCCCGCCCCCGGGACGCCT
ATCCTGTCCGAGAATGACACCAGGGTGATCTGCACTTTCTTCGCGGACATGACGTCCAACCACTACAATACGCCC
TCGTTCGGAGAAGGCATCACGTTGAGCGAGGCCTGGATGAACCTGCCGCCCCAGTTCATGGGCACCGCCACGTCG
TACGGCTCTCACGATCCCTCGCTGCACAATCAGCCCTTTACTGCAGCGGATCAGCCGCCGCATCAGCCCAGGCAC
AACCACAACAGCAGCAGCACCAGCAACACCACCAGCTACCACACCCGCTACCACATACGCTACCACACCCAATAC
CACACCCGCTACCACACCAACAGCACCATCAACAGCCCCAGTCGCAGCCTCATTCACAGCCTCATCAACAGTCCC
ATCAACAGTCCCATCAACAGTCCCACCAACAGTCCCATCAACAGTCCCATCAACAATCCCATCAATTACATCATC
ATCAACAACACCATCAACTATACCATCAACATCCACAGCATCACCACCCGCCCTCGGATGACGTCCTCAACGCAG
CCGCCACCTTGGTCCAGAGCGCCCCTCTCGGCCGCATCCCCGCCCCCAGGACAAGCGAGCCCCAACTTTCGCGGC
TGTCCCACACTTCTGACCATGGAGGTGGATCATGGCCCTCCGCTCGTCGACTGGATGTGGGGCTCCAGGCCTGTC
CCTGCTGCCCGCAGGCCGACGGCACCCGTCGAGGACTTCCAGTGGGGATCCGATGCCAGCTTCGGCCCAGCCCCT
CAGGGCTACGCGCCGGAGCAGCCAGCCCAGGCAGCGGCCGACGTCGTGTCGCAGACGCATATGAGGTGTCTCGAC
TGCCTCCAAGTCAACCCCAGCGCCGCCAACACCAGGACTAACAGTCCCGCTGCCCTCGGAAACACTGTCGGCGAC
GTGTCCGCCTACATCAAGAGGGAGGAAGACCACGGCGTGCCGCCGCGCAAGAGGCGGAAAAGCGAAAATTTCAAG
GAACCCGTCGACGACCCAGATGACAACCAAGACAACGACGTCGGCAAGAGGCGGAGGTCAAGAACCGACAGACTG
GACGATGCCTCGCCGCGGGCCGTCGAAGCCACGCCGGCACCTCCCAGTCGGCGGCGCAAGTCGACGGCCAACGGC
ACCAAGCCGCCGAGGGAGAACCTGACGGAGGAGCAGAAGCGCGAGAACCACATCCGCAGCGAGCAGAAACGCCGC
ACTCTGATTAAGGAGGGCTTCGACGATCTATGCGACCTGGTCCCCGGCCTCAAGGGCGGCGGCTTCAGCAAGAGT
ACCATGCTGTCCCTAACGGCCGAGTGGCTGGAGGAACTGATCGGCGGCAATCAGACCCTGGTCGCTCAGCTGGCG
GGGCTCGGCAACAAAGATGAGGAAGCTCGCTCCTGA
Transcript >Ophcf2|06689
ATGATCGCCGTGCAACTCGCTCCCAGCATGGCTCCCAGTACGGGTTCGTCGCCGCCGCCAGATTCCGACTCTGTC
CTCCCCTTTGGCTATGCCCTGGACCCGGCCGAGGAGCCGAGCTTCGATGTGCCCAATCCCGCCCCCGGGACGCCT
ATCCTGTCCGAGAATGACACCAGGGTGATCTGCACTTTCTTCGCGGACATGACGTCCAACCACTACAATACGCCC
TCGTTCGGAGAAGGCATCACGTTGAGCGAGGCCTGGATGAACCTGCCGCCCCAGTTCATGGGCACCGCCACGTCG
TACGGCTCTCACGATCCCTCGCTGCACAATCAGCCCTTTACTGCAGCGGATCAGCCGCCGCATCAGCCCAGGCAC
AACCACAACAGCAGCAGCACCAGCAACACCACCAGCTACCACACCCGCTACCACATACGCTACCACACCCAATAC
CACACCCGCTACCACACCAACAGCACCATCAACAGCCCCAGTCGCAGCCTCATTCACAGCCTCATCAACAGTCCC
ATCAACAGTCCCATCAACAGTCCCACCAACAGTCCCATCAACAGTCCCATCAACAATCCCATCAATTACATCATC
ATCAACAACACCATCAACTATACCATCAACATCCACAGCATCACCACCCGCCCTCGGATGACGTCCTCAACGCAG
CCGCCACCTTGGTCCAGAGCGCCCCTCTCGGCCGCATCCCCGCCCCCAGGACAAGCGAGCCCCAACTTTCGCGGC
TGTCCCACACTTCTGACCATGGAGGTGGATCATGGCCCTCCGCTCGTCGACTGGATGTGGGGCTCCAGGCCTGTC
CCTGCTGCCCGCAGGCCGACGGCACCCGTCGAGGACTTCCAGTGGGGATCCGATGCCAGCTTCGGCCCAGCCCCT
CAGGGCTACGCGCCGGAGCAGCCAGCCCAGGCAGCGGCCGACGTCGTGTCGCAGACGCATATGAGGTGTCTCGAC
TGCCTCCAAGTCAACCCCAGCGCCGCCAACACCAGGACTAACAGTCCCGCTGCCCTCGGAAACACTGTCGGCGAC
GTGTCCGCCTACATCAAGAGGGAGGAAGACCACGGCGTGCCGCCGCGCAAGAGGCGGAAAAGCGAAAATTTCAAG
GAACCCGTCGACGACCCAGATGACAACCAAGACAACGACGTCGGCAAGAGGCGGAGGTCAAGAACCGACAGACTG
GACGATGCCTCGCCGCGGGCCGTCGAAGCCACGCCGGCACCTCCCAGTCGGCGGCGCAAGTCGACGGCCAACGGC
ACCAAGCCGCCGAGGGAGAACCTGACGGAGGAGCAGAAGCGCGAGAACCACATCCGCAGCGAGCAGAAACGCCGC
ACTCTGATTAAGGAGGGCTTCGACGATCTATGCGACCTGGTCCCCGGCCTCAAGGGCGGCGGCTTCAGCAAGAGT
ACCATGCTGTCCCTAACGGCCGAGTGGCTGGAGGAACTGATCGGCGGCAATCAGACCCTGGTCGCTCAGCTGGCG
GGGCTCGGCAACAAAGATGAGGAAGCTCGCTCCTGA
Gene >Ophcf2|06689
ATGATCGCCGTGCAACTCGCTCCCAGCATGGCTCCCAGTACGGGTTCGTCGCCGCCGCCAGATTCCGACTCTGTC
CTCCCCTTTGGCTGTTCGTGCCGCTTCTCTAGCCCTTCCATCCCCCTCTGCGTCGACTGATCTCTTCCAGATGCC
CTGGACCCGGCCGAGGAGCCGAGCTTCGATGTGCCCAATCCCGCCCCCGGGACGCCTATCCTGTCCGAGAATGAC
ACCAGGGTGATCTGCACTTTCTTCGCGGACATGACGTCCAACCACTACAATACGCCCTCGTTCGGAGAAGGCATC
ACGTTGAGCGAGGCCTGGATGAACCTGCCGCCCCAGTTCATGGGCACCGCCACGTCGTACGGCTCTCACGATCCC
TCGCTGCACAATCAGCCCTTTACTGCAGCGGATCAGCCGCCGCATCAGCCCAGGGTCATGCCTTTAGAAACGCAG
CTCATACCGCCTCCCACCCAATCATTTCACCACCTCCAAACAGCACAACCACAACAGCAGCAGCACCAGCAACAC
CACCAGCTACCACACCCGCTACCACATACGCTACCACACCCAATACCACACCCGCTACCACACCAACAGCACCAT
CAACAGCCCCAGTCGCAGCCTCATTCACAGCCTCATCAACAGTCCCATCAACAGTCCCATCAACAGTCCCACCAA
CAGTCCCATCAACAGTCCCATCAACAATCCCATCAATTACATCATCATCAACAACACCATCAACTATACCATCAA
CATCCACAGCATCACCACCCGCCCTCGGATGACGTCCTCAACGCAGCCGCCACCTTGGTCCAGAGCGCCCCTCTC
GGCCGCATCCCCGCCCCCAGGACAAGCGAGCCCCAACTTTCGCGGCTGTCCCACACTTCTGACGTCGGTCACCGG
CGCCATCAGCTTCTCGAAGAGTTCACGGCCGAGACTCGGAGGAGCAGCATGGAGGTGGATCATGGCCCTCCGCTC
GTCGACTGGATGTGGGGCTCCAGGCCTGTCCCTGCTGCCCGCAGGCCGACGGCACCCGTCGAGGACTTCCAGTGG
GGATCCGATGCCAGCTTCGGCCCAGCCCCTCAGGGCTACGCGCCGGAGCAGCCAGCCCAGGCAGCGGCCGACGTC
GTGTCGCAGACGCATATGAGGTGTCTCGACTGCCTCCAAGTCAACCCCAGCGCCGCCAACACCAGGACTAACAGT
CCCGCTGCCCTCGGAAACACTGTCGGCGACGTGTCCGCCTACATCAAGAGGGAGGAAGACCACGGCGTGCCGCCG
CGCAAGAGGCGGAAAAGCGAAAATTTCAAGGAACCCGTCGACGACCCAGATGACAACCAAGACAACGACGTCGGC
AAGAGGCGGAGGTCAAGAACCGACAGACTGGACGATGCCTCGCCGCGGGCCGTCGAAGCCACGCCGGCACCTCCC
AGTCGGCGGCGCAAGTCGACGGCCAACGGCACCAAGCCGCCGAGGGAGAACCTGACGGAGGAGCAGAAGCGCGAG
AACCACATCCGCAGCGAGCAGAAACGCCGCACTCTGATTAAGGAGGGCTTCGACGATCTATGCGACCTGGTCCCC
GGCCTCAAGGGCGGCGGCTTCAGCAAGAGTACCATGCTGTCCCTAACGGCCGAGTGGCTGGAGGAACTGATCGGC
GGCAATCAGACCCTGGTCGCTCAGCTGGCGGGGCTCGGCAACAAAGATGAGGAAGCTCGCTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail