Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06688
Gene name
Locationscaffold_08:803974..809986
Strand-
Gene length (bp)6012
Transcript length (bp)3723
Coding sequence length (bp)3723
Protein length (aa) 1241

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01717 Meth_synt_2 Cobalamin-independent synthase, Catalytic domain 2.1E-146 501 824
PF08267 Meth_synt_1 Cobalamin-independent synthase, N-terminal domain 3.9E-110 70 383

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0008652 cellular amino acid biosynthetic process Yes
GO:0003871 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity Yes
GO:0009086 methionine biosynthetic process Yes
GO:0043169 cation binding No
GO:0044283 small molecule biosynthetic process No
GO:0003824 catalytic activity No
GO:0006520 cellular amino acid metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0005488 binding No
GO:0016740 transferase activity No
GO:0006555 methionine metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0009987 cellular process No
GO:0008168 methyltransferase activity No
GO:0043436 oxoacid metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0044237 cellular metabolic process No
GO:0044272 sulfur compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0009067 aspartate family amino acid biosynthetic process No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0006082 organic acid metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0009066 aspartate family amino acid metabolic process No
GO:0000097 sulfur amino acid biosynthetic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0008172 S-methyltransferase activity No
GO:0042085 5-methyltetrahydropteroyltri-L-glutamate-dependent methyltransferase activity No
GO:0000096 sulfur amino acid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0046914 transition metal ion binding No
GO:0016053 organic acid biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 856 878 22
2 971 988 17
3 1076 1094 18
4 1114 1136 22
5 1151 1170 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06688
MASARSEMRDASLMKLHSDMDSFYIQTTITSSLLLPSPRSTPDKPDLSDVSLFAIHRVNCHRAPANMVQSSILGF
PRMGPNRELKKATEAYWGGKLSQADLLSEAKRLRLSLWKIQKDAGVDVIPSNDFALYDQVLCHIQDFGAVPERYT
KDGLDTIDQYFAMGRGHQKGGVDVPSLEMVKWFDSNYHYVKPTFQDGQTFKLVDNPKPVAEFREAKDAGILTRPV
LVGPVSFLHLGKADRGQSVDPITLLDRLLPVYEQLLVQLKEAGVDTVQIDEPVLVFDLPAKTKAAFKPAYEKFAS
LGAKIPKIVFTTYFGDIVHNLDVLPVDVHAVHVDLVRNPEQLDAVMGALGPKTILSVGVVDGRNIWKTNMKSAIE
MVEKAIQKLGKERVIVATSSSLLHTPHTLASEKKLDPEVADWFSFACEKAVEIAVIAKAVTDGPASVRQQLEANA
KSMQSRATSTRTNDPHVKDRQSKVTDKDHKRKSEFPVRIAAQEKKLNLPMFPTTTIGSFPQTQEIRVQRNKLTKG
EIKVEEYDKFIEKEIRDNVKIQEELGLDVFVHGEPERNDMVQYFGERLKGYAFTTHAWVQSYGSRCVRPPIIVGD
ISRPAPMTVKESKYAVSVSKKPMKGMLTGPVTCLRWSFPRDDVHQSVQAQQLALALRDEVVDLEKAGVGVIQMDE
PALREGLPLRSGKERDAYLDWAVKAFKLSTSGVEDSTQIHSHFCYSEFQDFFHAIAALDADVLSIENSKSDAKLL
RVFVDSAYPRHIGPGVYDIHSPRVPSEQEIKDRIEEMLRYLKPEQLWIDPDCGLKTRQWKETKEALTNMVNAAKA
FRAKYSNEGLSAGLCFDGCASAVDLVASEAVFFFFFFFFFFFFFVQEAFAVGICPARPALSRWLASFVASWFSLR
LLQSKRNRGDAREAPQRDTSAGRTLDLTLFAVTQALDVIIGEVWSRRKARRVAEGVWNRLDDFVSRMTDPFSFIV
SCAFIMWAWFYAPESLPTSYRKWITSAAHIDARLIEALRRCRTGELRYGVDTGQAPLLGSMCSDYGLPPEWGDPA
RSIPFPCDVVHMGRGPSCEYHALRRFVHSWIWSMYTYMPLAAALQLRRPRRNSPLRALTSASRSSAFLATFITLF
YYGVCLGRSRIGPRLLGRDVWVRDWLDGGLCVANGCFLCGWSVLLETASRRKDMALFTAPRAMATLLPRRYPLRL
QWRERLAFAASTAVVFTCVQENPRRVRGMLGSILSLAMRQ*
Coding >Ophcf2|06688
ATGGCATCCGCCAGGTCGGAGATGCGGGACGCTTCTCTTATGAAGCTTCACTCCGACATGGATTCATTCTACATC
CAGACGACAATAACGAGCTCTTTGCTTCTGCCATCCCCGCGCTCAACCCCGGATAAGCCCGATCTCTCTGACGTC
TCACTATTTGCCATCCACCGCGTCAATTGTCACAGAGCTCCCGCCAACATGGTGCAGTCCTCTATTCTCGGCTTC
CCTCGCATGGGACCCAACCGCGAGCTAAAGAAGGCTACCGAGGCTTATTGGGGCGGCAAGCTGTCCCAGGCCGAT
CTCCTCAGCGAAGCAAAGCGGTTGCGCCTCTCCCTTTGGAAGATTCAAAAGGATGCGGGCGTCGACGTTATTCCC
AGCAATGATTTTGCCCTGTACGATCAGGTGCTTTGCCACATCCAGGACTTTGGTGCCGTCCCCGAACGCTACACC
AAAGACGGTCTTGACACTATCGACCAATACTTTGCCATGGGCCGTGGCCACCAGAAAGGAGGCGTCGATGTCCCC
AGCTTGGAAATGGTCAAGTGGTTTGATTCAAACTACCACTACGTCAAGCCCACCTTCCAGGACGGCCAGACCTTC
AAGCTTGTTGACAACCCCAAGCCAGTCGCCGAATTTCGCGAGGCCAAGGACGCCGGCATTCTGACTCGTCCTGTC
CTGGTAGGGCCCGTGAGCTTCCTCCATCTCGGCAAGGCCGACCGAGGACAATCAGTCGACCCCATCACTCTCCTC
GACAGGCTATTGCCCGTCTACGAACAGCTGCTGGTTCAGCTCAAGGAGGCCGGTGTCGACACCGTTCAGATCGAC
GAGCCGGTCCTTGTCTTCGATCTTCCTGCAAAGACCAAGGCCGCCTTCAAGCCGGCCTACGAGAAATTCGCCAGC
CTCGGTGCCAAGATCCCCAAAATCGTCTTCACAACATATTTTGGTGATATTGTTCACAACCTCGATGTGCTCCCC
GTGGACGTTCACGCCGTCCACGTCGATCTCGTTCGAAATCCCGAACAGCTTGACGCCGTTATGGGCGCTCTGGGC
CCTAAGACTATTCTGTCTGTCGGCGTCGTCGACGGTCGCAACATTTGGAAGACCAACATGAAGTCGGCCATTGAG
ATGGTGGAAAAAGCCATTCAGAAGCTTGGAAAGGAACGCGTCATCGTCGCGACATCAAGCTCCCTCTTACACACC
CCTCACACCCTGGCCAGCGAGAAGAAGCTCGACCCCGAGGTGGCTGACTGGTTCTCCTTCGCCTGCGAAAAGGCC
GTCGAGATTGCCGTCATTGCCAAGGCCGTCACCGATGGCCCTGCTTCCGTCCGTCAGCAGCTGGAGGCAAATGCC
AAGTCTATGCAGTCCCGCGCCACTTCCACCCGCACCAACGACCCGCATGTCAAGGATCGTCAGTCCAAGGTAACC
GACAAGGACCACAAGCGCAAGTCCGAGTTCCCCGTCCGCATCGCTGCGCAGGAAAAGAAGCTCAATCTCCCCATG
TTCCCAACGACGACGATCGGCTCGTTCCCGCAGACGCAGGAGATTCGCGTCCAGCGGAACAAGCTCACAAAGGGC
GAGATCAAGGTCGAAGAGTATGACAAGTTTATTGAGAAGGAGATACGGGACAACGTCAAGATCCAAGAGGAGCTT
GGCCTCGATGTCTTCGTGCACGGCGAGCCCGAGCGTAACGACATGGTTCAGTACTTTGGCGAGCGCCTCAAGGGT
TATGCCTTTACCACGCACGCCTGGGTGCAGAGCTACGGCTCTCGATGCGTCCGACCCCCGATCATTGTGGGCGAC
ATCTCCCGCCCTGCTCCCATGACGGTCAAGGAGTCCAAGTATGCCGTGTCGGTGTCCAAGAAGCCCATGAAGGGC
ATGCTCACCGGCCCCGTCACGTGCCTCCGATGGTCGTTCCCCCGCGACGACGTTCACCAGTCGGTCCAGGCTCAG
CAGCTTGCCCTGGCTCTGCGCGACGAAGTCGTGGACCTGGAGAAGGCCGGCGTCGGTGTCATCCAGATGGACGAG
CCCGCGCTTCGTGAGGGCCTGCCCCTTCGTTCCGGCAAGGAACGCGACGCCTACCTTGACTGGGCCGTCAAGGCG
TTCAAGCTGTCGACGTCGGGCGTGGAGGACTCGACGCAGATCCACTCGCACTTTTGCTATTCGGAGTTTCAGGAC
TTTTTCCACGCCATCGCGGCCCTCGACGCCGATGTGCTGTCGATTGAGAACAGCAAGTCGGACGCCAAGCTGCTT
CGCGTCTTTGTCGACTCTGCATATCCCCGTCACATTGGCCCGGGCGTGTATGACATTCACTCCCCCCGCGTTCCT
AGCGAGCAGGAGATCAAGGACCGCATCGAGGAGATGCTGCGCTACCTGAAGCCCGAGCAGCTGTGGATCGACCCG
GATTGCGGCCTCAAGACTCGGCAGTGGAAGGAGACCAAGGAGGCTTTGACCAACATGGTCAACGCAGCCAAGGCT
TTCCGGGCCAAGTACTCCAATGAGGGCTTATCTGCTGGGCTATGCTTCGACGGTTGCGCCTCGGCTGTTGACCTT
GTTGCTTCGGAGGCTGTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCGTCCAAGAGGCGTTCGCT
GTTGGCATCTGTCCTGCTCGTCCTGCTCTCTCAAGATGGCTAGCCTCCTTCGTCGCCTCCTGGTTCAGCCTCCGG
CTTCTCCAGTCAAAGCGAAACCGTGGCGACGCCCGAGAAGCACCGCAACGAGACACCAGCGCAGGCCGAACACTA
GACCTCACCCTCTTCGCCGTAACGCAAGCCCTCGACGTCATCATCGGTGAGGTCTGGTCCCGTCGAAAAGCCCGT
CGCGTCGCCGAAGGAGTCTGGAACAGGCTTGATGACTTCGTCTCCCGAATGACGGACCCCTTTAGCTTCATCGTC
TCGTGCGCATTCATCATGTGGGCTTGGTTCTACGCCCCCGAAAGCCTCCCGACAAGTTACCGCAAATGGATCACG
TCGGCCGCCCACATCGACGCCCGACTCATCGAAGCCCTCCGCCGATGCCGCACCGGCGAGCTCCGCTACGGCGTC
GACACCGGTCAGGCTCCGCTCCTCGGCTCCATGTGCTCCGACTACGGCCTTCCCCCCGAGTGGGGAGATCCGGCC
CGGTCCATCCCCTTCCCCTGCGACGTCGTCCACATGGGCCGCGGCCCTTCATGCGAATACCACGCGCTCCGTCGC
TTCGTCCACTCGTGGATCTGGTCCATGTACACGTACATGCCCCTGGCCGCCGCCCTACAACTCCGTCGTCCGCGA
CGCAACAGCCCGCTACGAGCCCTAACCTCAGCCTCCCGCTCATCCGCCTTCCTCGCCACCTTCATCACCCTCTTC
TACTACGGCGTCTGCCTCGGCCGCTCTCGCATCGGACCGCGTCTCCTCGGCCGCGACGTCTGGGTCCGCGACTGG
CTCGACGGCGGACTCTGCGTCGCCAACGGTTGCTTCCTCTGCGGCTGGAGCGTCTTGCTGGAGACGGCCTCTCGT
CGAAAGGACATGGCTCTCTTTACCGCCCCGAGAGCCATGGCTACCCTTTTGCCTCGTCGGTATCCGCTTCGGCTT
CAGTGGCGGGAGAGGCTCGCTTTTGCTGCCAGCACCGCCGTCGTCTTCACCTGCGTTCAGGAGAACCCGCGTCGG
GTCAGGGGCATGTTGGGGAGCATCCTCAGCCTGGCCATGCGCCAGTGA
Transcript >Ophcf2|06688
ATGGCATCCGCCAGGTCGGAGATGCGGGACGCTTCTCTTATGAAGCTTCACTCCGACATGGATTCATTCTACATC
CAGACGACAATAACGAGCTCTTTGCTTCTGCCATCCCCGCGCTCAACCCCGGATAAGCCCGATCTCTCTGACGTC
TCACTATTTGCCATCCACCGCGTCAATTGTCACAGAGCTCCCGCCAACATGGTGCAGTCCTCTATTCTCGGCTTC
CCTCGCATGGGACCCAACCGCGAGCTAAAGAAGGCTACCGAGGCTTATTGGGGCGGCAAGCTGTCCCAGGCCGAT
CTCCTCAGCGAAGCAAAGCGGTTGCGCCTCTCCCTTTGGAAGATTCAAAAGGATGCGGGCGTCGACGTTATTCCC
AGCAATGATTTTGCCCTGTACGATCAGGTGCTTTGCCACATCCAGGACTTTGGTGCCGTCCCCGAACGCTACACC
AAAGACGGTCTTGACACTATCGACCAATACTTTGCCATGGGCCGTGGCCACCAGAAAGGAGGCGTCGATGTCCCC
AGCTTGGAAATGGTCAAGTGGTTTGATTCAAACTACCACTACGTCAAGCCCACCTTCCAGGACGGCCAGACCTTC
AAGCTTGTTGACAACCCCAAGCCAGTCGCCGAATTTCGCGAGGCCAAGGACGCCGGCATTCTGACTCGTCCTGTC
CTGGTAGGGCCCGTGAGCTTCCTCCATCTCGGCAAGGCCGACCGAGGACAATCAGTCGACCCCATCACTCTCCTC
GACAGGCTATTGCCCGTCTACGAACAGCTGCTGGTTCAGCTCAAGGAGGCCGGTGTCGACACCGTTCAGATCGAC
GAGCCGGTCCTTGTCTTCGATCTTCCTGCAAAGACCAAGGCCGCCTTCAAGCCGGCCTACGAGAAATTCGCCAGC
CTCGGTGCCAAGATCCCCAAAATCGTCTTCACAACATATTTTGGTGATATTGTTCACAACCTCGATGTGCTCCCC
GTGGACGTTCACGCCGTCCACGTCGATCTCGTTCGAAATCCCGAACAGCTTGACGCCGTTATGGGCGCTCTGGGC
CCTAAGACTATTCTGTCTGTCGGCGTCGTCGACGGTCGCAACATTTGGAAGACCAACATGAAGTCGGCCATTGAG
ATGGTGGAAAAAGCCATTCAGAAGCTTGGAAAGGAACGCGTCATCGTCGCGACATCAAGCTCCCTCTTACACACC
CCTCACACCCTGGCCAGCGAGAAGAAGCTCGACCCCGAGGTGGCTGACTGGTTCTCCTTCGCCTGCGAAAAGGCC
GTCGAGATTGCCGTCATTGCCAAGGCCGTCACCGATGGCCCTGCTTCCGTCCGTCAGCAGCTGGAGGCAAATGCC
AAGTCTATGCAGTCCCGCGCCACTTCCACCCGCACCAACGACCCGCATGTCAAGGATCGTCAGTCCAAGGTAACC
GACAAGGACCACAAGCGCAAGTCCGAGTTCCCCGTCCGCATCGCTGCGCAGGAAAAGAAGCTCAATCTCCCCATG
TTCCCAACGACGACGATCGGCTCGTTCCCGCAGACGCAGGAGATTCGCGTCCAGCGGAACAAGCTCACAAAGGGC
GAGATCAAGGTCGAAGAGTATGACAAGTTTATTGAGAAGGAGATACGGGACAACGTCAAGATCCAAGAGGAGCTT
GGCCTCGATGTCTTCGTGCACGGCGAGCCCGAGCGTAACGACATGGTTCAGTACTTTGGCGAGCGCCTCAAGGGT
TATGCCTTTACCACGCACGCCTGGGTGCAGAGCTACGGCTCTCGATGCGTCCGACCCCCGATCATTGTGGGCGAC
ATCTCCCGCCCTGCTCCCATGACGGTCAAGGAGTCCAAGTATGCCGTGTCGGTGTCCAAGAAGCCCATGAAGGGC
ATGCTCACCGGCCCCGTCACGTGCCTCCGATGGTCGTTCCCCCGCGACGACGTTCACCAGTCGGTCCAGGCTCAG
CAGCTTGCCCTGGCTCTGCGCGACGAAGTCGTGGACCTGGAGAAGGCCGGCGTCGGTGTCATCCAGATGGACGAG
CCCGCGCTTCGTGAGGGCCTGCCCCTTCGTTCCGGCAAGGAACGCGACGCCTACCTTGACTGGGCCGTCAAGGCG
TTCAAGCTGTCGACGTCGGGCGTGGAGGACTCGACGCAGATCCACTCGCACTTTTGCTATTCGGAGTTTCAGGAC
TTTTTCCACGCCATCGCGGCCCTCGACGCCGATGTGCTGTCGATTGAGAACAGCAAGTCGGACGCCAAGCTGCTT
CGCGTCTTTGTCGACTCTGCATATCCCCGTCACATTGGCCCGGGCGTGTATGACATTCACTCCCCCCGCGTTCCT
AGCGAGCAGGAGATCAAGGACCGCATCGAGGAGATGCTGCGCTACCTGAAGCCCGAGCAGCTGTGGATCGACCCG
GATTGCGGCCTCAAGACTCGGCAGTGGAAGGAGACCAAGGAGGCTTTGACCAACATGGTCAACGCAGCCAAGGCT
TTCCGGGCCAAGTACTCCAATGAGGGCTTATCTGCTGGGCTATGCTTCGACGGTTGCGCCTCGGCTGTTGACCTT
GTTGCTTCGGAGGCTGTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCGTCCAAGAGGCGTTCGCT
GTTGGCATCTGTCCTGCTCGTCCTGCTCTCTCAAGATGGCTAGCCTCCTTCGTCGCCTCCTGGTTCAGCCTCCGG
CTTCTCCAGTCAAAGCGAAACCGTGGCGACGCCCGAGAAGCACCGCAACGAGACACCAGCGCAGGCCGAACACTA
GACCTCACCCTCTTCGCCGTAACGCAAGCCCTCGACGTCATCATCGGTGAGGTCTGGTCCCGTCGAAAAGCCCGT
CGCGTCGCCGAAGGAGTCTGGAACAGGCTTGATGACTTCGTCTCCCGAATGACGGACCCCTTTAGCTTCATCGTC
TCGTGCGCATTCATCATGTGGGCTTGGTTCTACGCCCCCGAAAGCCTCCCGACAAGTTACCGCAAATGGATCACG
TCGGCCGCCCACATCGACGCCCGACTCATCGAAGCCCTCCGCCGATGCCGCACCGGCGAGCTCCGCTACGGCGTC
GACACCGGTCAGGCTCCGCTCCTCGGCTCCATGTGCTCCGACTACGGCCTTCCCCCCGAGTGGGGAGATCCGGCC
CGGTCCATCCCCTTCCCCTGCGACGTCGTCCACATGGGCCGCGGCCCTTCATGCGAATACCACGCGCTCCGTCGC
TTCGTCCACTCGTGGATCTGGTCCATGTACACGTACATGCCCCTGGCCGCCGCCCTACAACTCCGTCGTCCGCGA
CGCAACAGCCCGCTACGAGCCCTAACCTCAGCCTCCCGCTCATCCGCCTTCCTCGCCACCTTCATCACCCTCTTC
TACTACGGCGTCTGCCTCGGCCGCTCTCGCATCGGACCGCGTCTCCTCGGCCGCGACGTCTGGGTCCGCGACTGG
CTCGACGGCGGACTCTGCGTCGCCAACGGTTGCTTCCTCTGCGGCTGGAGCGTCTTGCTGGAGACGGCCTCTCGT
CGAAAGGACATGGCTCTCTTTACCGCCCCGAGAGCCATGGCTACCCTTTTGCCTCGTCGGTATCCGCTTCGGCTT
CAGTGGCGGGAGAGGCTCGCTTTTGCTGCCAGCACCGCCGTCGTCTTCACCTGCGTTCAGGAGAACCCGCGTCGG
GTCAGGGGCATGTTGGGGAGCATCCTCAGCCTGGCCATGCGCCAGTGA
Gene >Ophcf2|06688
ATGGCATCCGCCAGGTCGGAGATGCGGGACGCTTCTCTTATGAAGCTTCACTCCGACATGGATTCATTCTACATC
CAGACGACAATAACGAGCTCTTTGCTTCTGCCATCCCCGCGCTCAACCCCGGATAAGCCCGATGTGCGACACCAG
AGTGCAGCGTCACATCCGAAAGCCTCCACACACAATCACATGGTGGCAAGCAAATATGTATGTATGCACAAAAAG
GAAAAAAAATAAATACAGGCCTAAATACATAGGAAGGAAAAATGCCGTCGTGACAAAAGAACCCCCCGACCTAAA
GCGGCCATGACACCGACCCCGGCCGGTTCCGCCGTAAGGATCGCAACCTGGACCTTTCATACATACATTATGTAT
GTATGTATGTATGTATGTATCATCATGATACATACATACACTCAGTATGTATGTCTATACGAATATATAACTACG
GATACAGGCTATGAAAGGATTAATATCCTAGACAAAATATCCTTAGTTCCTTCCGAGGCTCAGCCGCCTGCTTAT
AGCCACCGTCTCGTCGCCTCGGCTTCATCATGTCAGGGCCGGACGATGCCTATATTAGTATGTACATACAATGGA
TGGTATGTATCAAGCCCTTGTACGAAGTAGTACACTGTACATGAATTGCCTGCTCGAACATAAATACATGCAAAC
ACTTCGATAGTATTTGCAGTAATGTGCTCAAATGCTTCATTATCTTGATCATCATATACATACATGCATACTTCA
GTACCTATGTATGTATCCGTCCTCATAAATGTAGCTATGTAGGTATGTAGATATGTATGTATGTATGTTGTGCTT
TTTATGGTTTTGACGGAGTTTCCTGAGAAAAGTCTTCCGCTACACAGCAACTGTCTATATTGTACCTGTGTTACG
GAGCTATGGGCTAATACCGGTTCGCTAGCCGTCTTCATCTGCTGTCGCTGATAGCTCTCTATCAAACTACATCTT
CGGGCACCCGCCCACTTTATTTACCCCTCTCTCAGAACCCCTCATTGGGTCTTGACATCTTGTTGATCAATCTTC
TCCTCTCCTCCCCTCTCTCTCCCTCTCTCCCGCTCTCTGTCTCGTCTCAGCTCTCTGACGTCTCACTATTTGCCA
TCCACCGCGTCAATTGTCACGTTCGTCTGCTCTGTCCGCGTGCCGTCTTCAGCTAACGCAGAGCCTCCACAGAGA
GCTCCCGCCAACATGGTGCAGTCCTCTATTCTCGGCTTCCCTCGCATGGGACCCAACCGCGAGCTAAAGAAGGCT
ACCGAGGCTTGTGAGTTGCCCCTACGCTTATATCGACGTCAGGTTCTCATGTCTGCAGATTGGGGCGGCAAGCTG
TCCCAGGCCGATCTCCTCAGCGAAGCAAAGCGGTTGCGCCTCTCCCTTTGGAAGATTCAAAAGGATGCGGGCGTC
GACGTTATTCCCAGCAATGATTTTGCCCTGTACGATCAGGTGCTTTGCCACATCCAGGACTTTGGTGTACGCCTT
CCCACCCCAATTGCCTGGCCACGACACTGACTAGGTAATAGGCCGTCCCCGAACGCTACACCAAAGACGGTCTTG
ACACTATCGACCAATACTTTGCCATGGGCCGTGGCCACCAGAAAGGAGGCGTCGATGTCCCCAGCTTGGAAATGG
TCAAGTGGTTTGATTCAAACTACCACTACGTCAAGCCCACCTTCCAGGACGGCCAGACCTTCAAGCTTGTTGACA
ACCCCAAGCCAGTCGCCGAATTTCGCGAGGCCAAGGACGCCGGCATTCTGACTCGTCCTGTCCTGGTAGGGCCCG
TGAGCTTCCTCCATCTCGGCAAGGCCGACCGAGGACAATCAGTCGACCCCATCACTCTCCTCGACAGGCTATTGC
CCGTCTACGAACAGCTGCTGGTTCAGCTCAAGGAGGCCGGTGTCGACACCGTTCAGATCGACGAGCCGGTCCTTG
TCTTCGATCTTCCTGCAAAGACCAAGGCCGCCTTCAAGCCGGCCTACGAGAAATTCGCCAGCCTCGGTGCCAAGA
TCCCCAAAATCGTCTTCACAACATATTTTGGTGATATTGTTCACAACCTCGATGTGCTCCCCGTGGACGTTCACG
CCGTCCACGTCGATCTCGTTCGAAATCCCGAACAGCTTGACGCCGTTATGGGCGCTCTGGGCCCTAAGACTATTC
TGTCTGTCGGCGTCGTCGACGGTCGCAACATTTGGAAGACCAACATGAAGTCGGCCATTGAGATGGTGGAAAAAG
CCATTCAGAAGCTTGGAAAGGAACGCGTCATCGTCGCGACATCAAGCTCCCTCTTACACACCCCTCACACCCTGG
CCAGCGAGAAGAAGCTCGACCCCGAGGTGGCTGACTGGTTCTCCTTCGCCTGCGAAAAGGCCGTCGAGATTGCCG
TCATTGCCAAGGCCGTCACCGATGGCCCTGCTTCCGTCCGTCAGCAGCTGGAGGCAAATGCCAAGTCTATGCAGT
CCCGCGCCACTTCCACCCGCACCAACGACCCGCATGTCAAGGATCGTCAGTCCAAGGTAACCGACAAGGACCACA
AGCGCAAGTCCGAGTTCCCCGTCCGCATCGCTGCGCAGGAAAAGAAGCTCAATCTCCCCATGTTCCCAACGACGA
CGATCGGCTCGTTCCCGCAGACGCAGGAGATTCGCGTCCAGCGGAACAAGCTCACAAAGGGCGAGATCAAGGTCG
AAGAGTATGACAAGTTTATTGAGAAGGAGATACGGGACAACGTCAAGATCCAAGAGGAGCTTGGCCTCGATGTCT
TCGTGCACGGCGAGCCCGAGCGTAACGACATGGTTCAGTACTTTGGCGAGCGCCTCAAGGGTTATGCCTTTACCA
CGCACGCCTGGGTGCAGAGCTACGGCTCTCGATGCGTCCGACCCCCGATCATTGTGGGCGACATCTCCCGCCCTG
CTCCCATGACGGTCAAGGAGTCCAAGTATGCCGTGTCGGTGTCCAAGAAGCCCATGAAGGGCATGCTCACCGGCC
CCGTCACGTGCCTCCGATGGTCGTTCCCCCGCGACGACGTTCACCAGTCGGTCCAGGCTCAGCAGCTTGCCCTGG
CTCTGCGCGACGAAGTCGTGGACCTGGAGAAGGCCGGCGTCGGTGTCATCCAGATGGACGAGCCCGCGCTTCGTG
AGGGCCTGCCCCTTCGTTCCGGCAAGGAACGCGACGCCTACCTTGACTGGGCCGTCAAGGCGTTCAAGCTGTCGA
CGTCGGGCGTGGAGGACTCGACGCAGATCCACTCGCACTTTTGCTATTCGGAGTTTCAGGACTTTTTCCACGCCA
TCGCGGCCCTCGACGCCGATGTGCTGTCGATTGAGAACAGCAAGTCGGACGCCAAGCTGCTTCGCGTCTTTGTCG
ACTCTGCATATCCCCGTCACATTGGCCCGGGCGTGTATGACATTCACTCCCCCCGCGTTCCTAGCGAGCAGGAGA
TCAAGGACCGCATCGAGGAGATGCTGCGCTACCTGAAGCCCGAGCAGCTGTGGATCGACCCGGATTGCGGCCTCA
AGACTCGGCAGTGGAAGGAGACCAAGGAGGCTTTGACCAACATGGTCAACGCAGCCAAGGCTTTCCGGGCCAAGT
ACTCCAAGTAAGTGGTCGGGTGGAGGGAGAGTTTGGGATTCTGCGAAAAGTGTGTTTTATAAGCCGGCATCGACT
TCAACATCGGCGTTTCTTTGGGGGCGAGGACATGTGAGGCCGCGAAGGGGATCAGACGACATGGACCGGGGCGGC
GGCGAGCAGATAGCGGCAGAGAAGCTGGGTGTGCATATTCAACATTGATGAATCCATGAGGTAGATGAGAATGAG
GTTGTTGCGATGGATCTGTTGTATTATGTGTGATACTTGTCCGTAGTCTTCGTAGAGCTCTATGAAGATACAGTC
GTACATGCATGCATACATATGTATATATTGTTGTGCCCTCTCGGGCCCTGTCACGTGACAGACTAGCACTGTATA
GGGCAGCCCTCTCGCACAGGCTGCTAGCTAGATTCGTGCATCCTACATCATCACGTTGTGATGCACTTCGACACA
CATCTCTCCCTTGCTCTATGACATATATCTCCCGGATGGGCGGGATGGACCGATATATACTGTAGATACACTGTA
CGGAAAACTGTACGGCTTCCCGCCGCTCCCCGGCATTCCGGCCCTCCGAAGAGCCATTTCACCCCCTTTCCCACC
CCTCCCCACCTCTTCCCCTCCCCATGCCGGGGACACGAAGACTTCCGACACGAAGACTTCCACTCCCCAGAGGCC
ACGACGCGTCCGGTCTCGGAGGCACACGCGAGACGATCCAACGGCCAATTGCTAGCGGCGGCGGCAAGCCAACCT
CCATCCGGCCGGAGAAGGGCGAAAGTAGGAGGCTCGGGCCCGCTAACGGGGGGCTCCCTTGATGCGTCAGACGAC
ATCCATCATCATCATCATCATCATCATCATCATCATCATCAGCATGAGCGGCCTCCCGTTCGTCTTGACCGCTTC
ACGACCGCTGAGATGTCGCGAGACGGTCGCGTGCCGTCTTTATCGAGGGCGCTGCGTCCGTTAGTGAGGGCTTAT
CTGCTGGGCTATGCTTCGACGGTTGCGCCTCGGCTGTTGACCTTGTTGCTTCGGAGGCTGTCTTCTTCTTCTTCT
TCTTCTTCTTCTTCTTCTTCTTCTTCGTCCAAGAGGCGTTCGCTGTTGGCATCTGTCCTGCTCGTCCTGCGTACC
GGTCTTGAGCCGCGTCGCTTTCCTGCCTTTTGCGCCTTGCTCGTTGGCGGCTCGACCCTCTTCTACGTTGGAATT
CTACCCCTCCCCCCCCTTTCCTATATCACGCTCATTTTCAAGAGCATCACGACTAATCCGTCTCTCTCACTTCAG
AAGCCATTGAATCTCCTCGTCTCTCGCATCACCCGTTCTCATCTCACAGACGCCGCTTCTCTCAGTCTCTCAAGA
TGGCTAGCCTCCTTCGTCGCCTCCTGGTTCAGCCTCCGGCTTCTCCAGTCAAAGCGAAACCGTGGCGACGCCCGA
GAAGCACCGCAACGAGACACCAGCGCAGGCCGAACACTAGACCTCACCCTCTTCGCCGTAACGCAAGCCCTCGAC
GTCATCATCGGTGAGGTCTGGTCCCGTCGAAAAGCCCGTCGCGTCGCCGAAGGAGTCTGGAACAGGCTTGATGAC
TTCGTCTCCCGAATGACGGACCCCTTTAGCTTCATCGTCTCGTGCGCATTCATCATGTGGGCTTGGTTCTACGCC
CCCGAAAGCCTCCCGACAAGTTACCGCAAATGGATCACGTCGGCCGCCCACATCGACGCCCGACTCATCGAAGCC
CTCCGCCGATGCCGCACCGGCGAGCTCCGCTACGGCGTCGACACCGGTCAGGCTCCGCTCCTCGGCTCCATGTGC
TCCGACTACGGCCTTCCCCCCGAGTGGGGAGATCCGGCCCGGTCCATCCCCTTCCCCTGCGACGTCGTCCACATG
GGCCGCGGCCCTTCATGCGAATACCACGCGCTCCGTCGCTTCGTCCACTCGTGGATCTGGTCCATGTACACGTAC
ATGCCCCTGGCCGCCGCCCTACAACTCCGTCGTCCGCGACGCAACAGCCCGCTACGAGCCCTAACCTCAGCCTCC
CGCTCATCCGCCTTCCTCGCCACCTTCATCACCCTCTTCTACTACGGCGTCTGCCTCGGCCGCTCTCGCATCGGA
CCGCGTCTCCTCGGCCGCGACGTCTGGGTCCGCGACTGGCTCGACGGCGGACTCTGCGTCGCCAACGGTTGCTTC
CTCTGCGGCTGGAGCGTCTTGCTGGAGACGGCCTCTCGTCGAAAGGACATGGCTCTCTTTACCGCCCCGAGAGCC
ATGGCTACCCTTTTGCCTCGTCGGTATCCGCTTCGGCTTCAGTGGCGGGAGAGGCTCGCTTTTGCTGCCAGCACC
GCCGTCGTCTTCACCTGCGTTCAGGAGAACCCGCGTCGGGTCAGGGGCATGTTGGGGAGCATCCTCAGCCTGGCC
ATGCGCCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail