Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06685
Gene name
Locationscaffold_08:795223..796775
Strand+
Gene length (bp)1552
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 5.2E-34 32 137
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 8.2E-16 176 302
PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus 3.3E-12 147 345
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 1.2E-07 227 338

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06685
MTSLPKEMKALRYEKPEDWSIVKVPLPELRDHDVLVQVKACGVCGTDLHIHEGEFIAKFPLIPGHETVGVIVAVG
ESVKGFQIGDRVAADNSELCNECFYCRRGQLLLCENFNAHGVTLDGGFAEYCAYPAAKVFKIKNLNWVDATLIEP
ASCACHGLEKIRPKLGSHVLMFGAGPTGLMLAQLLRQNGGCQVTIAAPKGLKMDLAKSLDAADTYVELSREDPGP
QFAKIKQDSPYGFDIVIEATGSVKILEDAIHYVRRGGTLVVYGVYASSDKVSWPPSKIFGDEITIIGSFSETYMF
PATIDYLDSGKVRTKGIVNKTFKLEEFGEALQSIRDKSAIKAAIVFD*
Coding >Ophcf2|06685
ATGACGTCGCTTCCCAAGGAGATGAAGGCGCTGAGGTACGAAAAGCCTGAGGATTGGTCCATCGTCAAGGTGCCG
CTACCGGAGCTGCGAGACCACGATGTGTTGGTGCAGGTCAAGGCCTGCGGTGTTTGTGGCACTGATCTGCACATC
CATGAGGGCGAGTTCATCGCCAAATTCCCTTTGATTCCCGGTCATGAGACGGTGGGCGTCATCGTTGCCGTCGGC
GAGAGCGTCAAAGGCTTCCAGATCGGAGACCGCGTCGCCGCAGACAACAGCGAGCTGTGCAATGAGTGTTTCTAC
TGCCGCCGAGGCCAGCTGCTGCTGTGTGAGAACTTCAATGCTCACGGCGTCACGCTCGACGGCGGCTTCGCGGAG
TACTGCGCATATCCAGCTGCCAAGGTCTTCAAGATCAAGAACCTCAATTGGGTGGACGCTACATTGATCGAGCCC
GCTTCTTGCGCCTGCCATGGGCTGGAAAAGATCAGGCCCAAGCTTGGCTCGCACGTCTTGATGTTCGGAGCGGGC
CCAACCGGGCTTATGCTCGCTCAGTTGCTACGGCAGAACGGGGGCTGCCAGGTCACCATCGCGGCGCCCAAGGGT
CTCAAGATGGACCTTGCCAAGAGTCTCGACGCTGCTGATACCTATGTCGAGCTCTCGCGCGAGGACCCCGGGCCG
CAGTTTGCCAAGATCAAGCAAGACAGCCCGTACGGCTTCGACATTGTGATCGAGGCCACTGGCTCGGTCAAGATT
CTGGAGGATGCCATCCACTATGTGCGCCGTGGGGGCACTCTTGTCGTTTACGGCGTGTACGCATCCTCGGACAAG
GTCTCTTGGCCTCCGTCCAAGATCTTTGGAGATGAGATCACCATCATCGGCTCCTTCTCGGAGACGTACATGTTC
CCGGCCACGATTGACTATCTCGACTCGGGCAAGGTCAGGACCAAGGGCATTGTGAATAAGACGTTTAAACTGGAG
GAGTTTGGCGAAGCTCTGCAGAGCATCAGGGACAAGAGCGCCATCAAGGCAGCCATCGTGTTTGATTAA
Transcript >Ophcf2|06685
ATGACGTCGCTTCCCAAGGAGATGAAGGCGCTGAGGTACGAAAAGCCTGAGGATTGGTCCATCGTCAAGGTGCCG
CTACCGGAGCTGCGAGACCACGATGTGTTGGTGCAGGTCAAGGCCTGCGGTGTTTGTGGCACTGATCTGCACATC
CATGAGGGCGAGTTCATCGCCAAATTCCCTTTGATTCCCGGTCATGAGACGGTGGGCGTCATCGTTGCCGTCGGC
GAGAGCGTCAAAGGCTTCCAGATCGGAGACCGCGTCGCCGCAGACAACAGCGAGCTGTGCAATGAGTGTTTCTAC
TGCCGCCGAGGCCAGCTGCTGCTGTGTGAGAACTTCAATGCTCACGGCGTCACGCTCGACGGCGGCTTCGCGGAG
TACTGCGCATATCCAGCTGCCAAGGTCTTCAAGATCAAGAACCTCAATTGGGTGGACGCTACATTGATCGAGCCC
GCTTCTTGCGCCTGCCATGGGCTGGAAAAGATCAGGCCCAAGCTTGGCTCGCACGTCTTGATGTTCGGAGCGGGC
CCAACCGGGCTTATGCTCGCTCAGTTGCTACGGCAGAACGGGGGCTGCCAGGTCACCATCGCGGCGCCCAAGGGT
CTCAAGATGGACCTTGCCAAGAGTCTCGACGCTGCTGATACCTATGTCGAGCTCTCGCGCGAGGACCCCGGGCCG
CAGTTTGCCAAGATCAAGCAAGACAGCCCGTACGGCTTCGACATTGTGATCGAGGCCACTGGCTCGGTCAAGATT
CTGGAGGATGCCATCCACTATGTGCGCCGTGGGGGCACTCTTGTCGTTTACGGCGTGTACGCATCCTCGGACAAG
GTCTCTTGGCCTCCGTCCAAGATCTTTGGAGATGAGATCACCATCATCGGCTCCTTCTCGGAGACGTACATGTTC
CCGGCCACGATTGACTATCTCGACTCGGGCAAGGTCAGGACCAAGGGCATTGTGAATAAGACGTTTAAACTGGAG
GAGTTTGGCGAAGCTCTGCAGAGCATCAGGGACAAGAGCGCCATCAAGGCAGCCATCGTGTTTGATTAA
Gene >Ophcf2|06685
ATGACGTCGCTTCCCAAGGAGATGAAGGCGCTGAGGTGTCATGCCCGGCTCTACCTCCGAAGACATTCGTTGACC
CGGTAACGTCTAGGTACGAAAAGCCTGAGGATTGGTCCATCGTCAAGGTGCCGCTACCGGAGCTGCGAGACCACG
ATGTGTTGGTGCAGGTCAAGGCCTGCGGTGTTTGTGGCACTGGTGCGCGCTGATGAGGCAGATATGGACAGGAAA
GTAGTTGGCTAATGCGGGCGTCGTGCAGATCTGGTGGGCATCGGTTCATCCGAGTCATCTTGGCTTACACGTGGC
TGATATAGATTCAAGCACATCCATGAGGGCGAGTTCATCGCCAAATTCCCTTTGATTCCCGGTCATGAGACGGTG
GGCGTCATCGTTGCCGTCGGCGAGGTGAGACGAGGCCGGCCGGTGACTGCACACGACAAGCAGCTGAATTGCTCA
GAGCGTCAAAGGCTTCCAGATCGGAGACCGCGTCGCCGCAGACAACAGCGAGCTGTGCAATGAGTGTTTCTACTG
CCGCCGAGGCCAGCTGCTGCTGTGTGAGAACGTGCGTGGCTTCGTTTCGGTCTATAGGCTGGTGGATCTGACTGC
TTCCGGGACAGTTCAATGCTCACGGCGTCACGCTCGACGGCGGCTTCGCGGAGTACTGCGCATATCCAGCTGCCA
AGGTCTTCAAGATCAAGAACCTCAATTGGGTGGACGCTACATTGATCGAGCCCGCTTCTTGCGCCTGCCATGGGC
TGGAAAAGATCAGGCCCAAGCTTGGCTCGCACGTCTTGATGTTCGGAGCGGGCCCAACCGGGCTTGTAAGTCTTA
GCCGTGCCAGTTTCGGAACTATTGTTGATGACTGCTTCCTGCAAGATGCTCGCTCAGTTGCTACGGCAGAACGGG
GGCTGCCAGGTCACCATCGCGGCGCCCAAGGGTCTCAAGATGGACCTTGCCAAGAGTCTCGACGCTGCTGATACC
TATGTCGAGCTCTCGCGCGAGGACCCCGGGCCGCAGTTTGCCAAGATCAAGCAAGACAGCCCGTACGGCTTCGAC
ATTGGTCAGTCGCTCCGTCTTAGTCTTTGGCAGCCGTATTTCGCCCATGATGAGGCTGACCATAGTCAGTGATCG
AGGCCACTGGCTCGGTCAAGATTCTGGAGGATGCCATCCACTATGTGCGCCGTGGGGGCACTCTTGTCGTTTACG
GGTAGAAGTGGCCCTCTCGAAGGCTTAGACGCAGCTGACATGTCTCAGCGTGTACGCATCCTCGGACAAGGTCTC
TTGGCCTCCGTCCAAGATCTTTGGAGATGAGATCACCATCATCGGCTCCTTCTCGGAGACGTACATGTTCCGTAT
GTTGACTTGCCAGACGAGAGCGAGTGCAAAGCTTCGTGACTGACGCCTCATCGATGCAGCGGCCACGATTGACTA
TCTCGACTCGGGCAAGGTCAGGACCAAGGGCATTGTGAATAAGACGTTTAAACTGGAGGAGTTTGGCGAAGCTCT
GCAGAGCATCAGGGACAAGAGCGCCATCAAGGCAGCCATCGTGTTTGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail