Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06667
Gene name
Locationscaffold_08:759490..761533
Strand-
Gene length (bp)2043
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 3.4E-07 257 319

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3744 0.9065 0.0532 0.0295 0.0738 0.0103 0.0449 0.0195 0.004 0.0061

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1355
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4033
Ophiocordyceps australis map64 (Brazil) OphauB2|3251
Ophiocordyceps camponoti-floridani Ophcf2|06667 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6030
Ophiocordyceps kimflemingae Ophio5|7465
Ophiocordyceps subramaniannii Hirsu2|10764

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06667
MADDDRYGGKRSRFDQTEPDSRRSSRFDRRSRSPSARRVEARDRSPIARDGAPSEARSPPVDPAAAAAAAAARIN
AQLQARKGIQHVDVPPIQKPDQDQSPTTPSRPALSNSSGPPRQIDGEMYVSDGDYIKDIEVNDLRNRYVLTKSST
QKMIKEQTGADVTTRGSYYPNKNMATAANPPLHLHVTSTTKEGLEAAVAKIQEYIQQELPQLVDERRFRRRDQEQ
PHVERDEYGRRKWPEEKVFVGLEPVPGFNLRAQIVGSGGSYVKHIQSETGCRVQIKGRGSGYLEIATNRECDEDM
FLHVTGPDPKMVEKGKELCEDLVANVRDQYEEFKTRPPRHGDRGGYGDHHRGGRPHDQSYSYGRSASDHQVSTSA
NAGDGAANNAASAADWSQYAAQYYANGQDPYAAYGGYQNYMAWYQYYYGQGATGQVAPGQVAPGQVAPGQSAAPP
PPSEAAPPPPPSDAPPPPPSSSSPPAPPASSTNFHAVPPPPGL*
Coding >Ophcf2|06667
ATGGCCGACGACGACCGCTACGGCGGCAAGCGATCACGCTTCGACCAGACCGAGCCCGACTCCAGACGCTCCTCC
CGCTTCGACCGACGCTCCCGCTCGCCGTCTGCGCGTCGCGTCGAGGCCCGCGATCGCAGCCCCATCGCCAGAGAT
GGTGCTCCTTCTGAAGCTCGCAGTCCTCCCGTTGACCCAGCAGCTGCCGCTGCCGCCGCTGCTGCCCGCATCAAC
GCCCAGTTGCAGGCTCGCAAGGGTATCCAGCATGTCGACGTTCCGCCCATCCAGAAGCCCGACCAGGACCAGTCT
CCTACTACCCCTTCGAGGCCCGCCCTCTCAAACAGTTCGGGTCCACCTCGCCAGATCGACGGCGAGATGTACGTC
TCGGACGGCGACTACATCAAGGATATAGAAGTCAACGACTTGCGGAATCGTTACGTGCTCACAAAGAGCTCTACG
CAAAAAATGATCAAGGAACAAACCGGCGCTGACGTTACCACGCGTGGCAGCTACTATCCCAACAAGAATATGGCT
ACCGCCGCCAATCCTCCCTTGCATCTACACGTAACGAGCACCACCAAAGAAGGACTGGAAGCTGCCGTGGCCAAG
ATTCAGGAATATATTCAGCAAGAGCTTCCGCAGCTTGTCGATGAGCGACGCTTCCGCAGACGTGATCAGGAGCAA
CCCCACGTCGAGCGTGACGAGTACGGACGGCGTAAATGGCCCGAAGAAAAGGTCTTTGTCGGTTTGGAGCCGGTG
CCCGGCTTCAACCTTCGTGCCCAAATCGTTGGCTCTGGCGGCTCTTACGTCAAGCACATTCAGTCGGAGACGGGC
TGCCGGGTGCAAATCAAAGGCCGAGGGTCCGGATATCTCGAGATCGCCACCAATCGTGAATGTGACGAGGACATG
TTTCTTCACGTAACAGGTCCCGACCCGAAAATGGTCGAAAAGGGCAAGGAGCTCTGCGAAGATTTGGTTGCCAAC
GTGCGAGACCAGTATGAGGAATTCAAGACCCGTCCTCCTCGTCACGGTGACCGCGGTGGCTACGGGGATCATCAT
CGAGGGGGTAGACCCCATGACCAGTCCTACTCGTACGGCCGGTCTGCTTCTGATCACCAGGTCTCAACCTCGGCC
AACGCCGGTGATGGAGCGGCCAACAACGCCGCCAGCGCCGCCGACTGGTCTCAGTACGCCGCGCAATACTACGCC
AACGGCCAGGATCCCTATGCCGCTTACGGCGGCTATCAGAACTACATGGCTTGGTATCAGTATTACTATGGCCAG
GGCGCAACCGGTCAAGTCGCGCCCGGTCAAGTTGCGCCCGGCCAAGTTGCGCCTGGTCAGTCGGCCGCACCACCT
CCCCCGAGCGAAGCGGCGCCTCCGCCTCCGCCAAGCGATGCTCCTCCGCCACCTCCCAGTTCCTCGTCGCCTCCT
GCCCCCCCTGCTTCAAGCACCAACTTTCACGCGGTCCCCCCTCCCCCGGGTCTTTAA
Transcript >Ophcf2|06667
ATGGCCGACGACGACCGCTACGGCGGCAAGCGATCACGCTTCGACCAGACCGAGCCCGACTCCAGACGCTCCTCC
CGCTTCGACCGACGCTCCCGCTCGCCGTCTGCGCGTCGCGTCGAGGCCCGCGATCGCAGCCCCATCGCCAGAGAT
GGTGCTCCTTCTGAAGCTCGCAGTCCTCCCGTTGACCCAGCAGCTGCCGCTGCCGCCGCTGCTGCCCGCATCAAC
GCCCAGTTGCAGGCTCGCAAGGGTATCCAGCATGTCGACGTTCCGCCCATCCAGAAGCCCGACCAGGACCAGTCT
CCTACTACCCCTTCGAGGCCCGCCCTCTCAAACAGTTCGGGTCCACCTCGCCAGATCGACGGCGAGATGTACGTC
TCGGACGGCGACTACATCAAGGATATAGAAGTCAACGACTTGCGGAATCGTTACGTGCTCACAAAGAGCTCTACG
CAAAAAATGATCAAGGAACAAACCGGCGCTGACGTTACCACGCGTGGCAGCTACTATCCCAACAAGAATATGGCT
ACCGCCGCCAATCCTCCCTTGCATCTACACGTAACGAGCACCACCAAAGAAGGACTGGAAGCTGCCGTGGCCAAG
ATTCAGGAATATATTCAGCAAGAGCTTCCGCAGCTTGTCGATGAGCGACGCTTCCGCAGACGTGATCAGGAGCAA
CCCCACGTCGAGCGTGACGAGTACGGACGGCGTAAATGGCCCGAAGAAAAGGTCTTTGTCGGTTTGGAGCCGGTG
CCCGGCTTCAACCTTCGTGCCCAAATCGTTGGCTCTGGCGGCTCTTACGTCAAGCACATTCAGTCGGAGACGGGC
TGCCGGGTGCAAATCAAAGGCCGAGGGTCCGGATATCTCGAGATCGCCACCAATCGTGAATGTGACGAGGACATG
TTTCTTCACGTAACAGGTCCCGACCCGAAAATGGTCGAAAAGGGCAAGGAGCTCTGCGAAGATTTGGTTGCCAAC
GTGCGAGACCAGTATGAGGAATTCAAGACCCGTCCTCCTCGTCACGGTGACCGCGGTGGCTACGGGGATCATCAT
CGAGGGGGTAGACCCCATGACCAGTCCTACTCGTACGGCCGGTCTGCTTCTGATCACCAGGTCTCAACCTCGGCC
AACGCCGGTGATGGAGCGGCCAACAACGCCGCCAGCGCCGCCGACTGGTCTCAGTACGCCGCGCAATACTACGCC
AACGGCCAGGATCCCTATGCCGCTTACGGCGGCTATCAGAACTACATGGCTTGGTATCAGTATTACTATGGCCAG
GGCGCAACCGGTCAAGTCGCGCCCGGTCAAGTTGCGCCCGGCCAAGTTGCGCCTGGTCAGTCGGCCGCACCACCT
CCCCCGAGCGAAGCGGCGCCTCCGCCTCCGCCAAGCGATGCTCCTCCGCCACCTCCCAGTTCCTCGTCGCCTCCT
GCCCCCCCTGCTTCAAGCACCAACTTTCACGCGGTCCCCCCTCCCCCGGGTCTTTAA
Gene >Ophcf2|06667
ATGGCCGACGACGACCGCTACGGCGGCAAGCGATCACGCTTCGACCAGACCGAGCCCGACTCCAGACGCTCCTCC
CGCTTCGACCGACGCTCCCGCTCGCCGTCTGCGCGTCGCGTCGAGGCCCGCGATCGCAGCCCCATCGCCAGAGAT
GGTGCTCCTTCTGAAGCTCGCAGTCCTCCCGTTGACCCAGCAGCTGCCGCTGGTGAGTCCCTTTTCTCCTCCCAA
GCCTCCCCGTCTCTCTTCGTGTAGCTGACTGCTCCCTCCAGCCGCCGCTGCTGCCCGCATCAACGCCCAGTTGCA
GGCTCGCAAGGGTATCCAGCATGTCGACGTTCCGCCCATCCAGAAGCCCGACCAGGACCAGTCTCCTACTACCCC
TTCGAGGCCCGCCCTCTCAAACAGTTCGGGTCCACCTCGCCAGATCGACGGCGAGATGTACGTCTCGGACGGCGA
CTACATCAAGGATATAGAAGTCAACGACTTGCGGAATCGTTACGTGCTCACAAAGAGCTCTACGCAAAAAATGGT
AATTATTCTAGATGCTCCACTGATGCTCCAGATGCACTCCAGCTCGGGCACTTGCAGTTGCTGCCTCACCACCAG
CACTACTTGCTTGCGTAGCGCACAGCTCGTATGCGTAAACCCTCTTTACTCCTACTAACTCCTATTGCATTAGAT
CAAGGAACAAACCGGCGCTGGTACGCATCAAATCCCCGCACGATCCCGCTACAGTGTTTGTTGACTCTTCGAACC
AAAAGACGTTACCACGCGTGGCAGCTACTATCCCAACAAGAATATGGCTACCGCCGCCGTCAGTTTCTTTGCTCC
TAGCCGATACGCTGAACTCGCCACTGAAATATGTCACAGAATCCTCCCTTGCATCTACACGTAACGAGCACCACC
AAAGAAGGACTGGAAGCTGCCGTGGCCAAGATTCAGGAATATATTCAGCAAGAGCTTCCGCAGCTTGTCGATGAG
CGACGCTTCCGCAGACGTGATCAGGAGCAACCCCACGTCGAGCGTGACGAGTACGGACGGGTATGACCACCTCAC
TATATCTGAACCGTCTACCTGTGCATATGTTGACCTGGCCTTTTCTCCCTTTGTGCAGCGTAAATGGCCCGAAGA
AAAGGTCTTTGTCGGTTTGGAGCCGGTGCCCGGCTTCAACCTTCGTGCCCAAATCGTTGGCTCTGGCGGCTCTTA
CGTCAAGCACATTCAGTCGGAGACGGGCTGCCGGGTGCAAATCAAAGGCCGAGGGTCCGGATATCTCGAGATCGC
CACCAATCGTGAATGTGACGAGGACATGTTTCTTCACGTAACGTTCGTGTCTTCACCATTCGCAAGGCTGCCACA
TCTGCTAATGATCCGTTACAGAGGTCCCGACCCGAAAATGGTCGAAAAGGGCAAGGAGCTCTGCGAAGATTTGGT
TGCCAACGTGCGAGACCAGTATGAGGAATTCAAGACCCGTCCTCCTCGTCACGGTGACCGCGGTGGCTACGGGGA
TCATCATCGAGGGGGTAGACCCCATGACCAGTCCTACTCGTACGGCCGGTCTGCTTCTGATCACCAGGTCTCAAC
CTCGGCCAACGCCGGTGATGGAGCGGCCAACAACGCCGCCAGCGCCGCCGACTGGTCTCAGTACGCCGCGCAATA
CTACGCCAACGGCCAGGATCCCTATGCCGCTTACGGCGGCTATCAGAAGTATGTCGCGACGTCCTGTCGATTAAC
ATGGTCTAACATCACGACAGCTACATGGCTTGGTATCAGTATTACTATGGCCAGGGCGCAACCGGTCAAGTCGCG
CCCGGTCAAGTTGCGCCCGGCCAAGTTGCGCCTGGTCAGTCGGCCGCACCACCTCCCCCGAGCGAAGCGGCGCCT
CCGCCTCCGCCAAGCGATGCTCCTCCGCCACCTCCCAGTTCCTCGTCGCCTCCTGCCCCCCCTGCTTCAAGCACC
AACTTTCACGCGGTAAGACATGTTCCCGTTGAGCCCCGCCCCGGCAGCGGTCGCTCATCTCACTATTAGGTCCCC
CCTCCCCCGGGTCTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail