Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06666
Gene name
Locationscaffold_08:757771..758752
Strand-
Gene length (bp)981
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06159 DUF974 Protein of unknown function (DUF974) 4.7E-76 73 299

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5594 0.4085 0.0492 0.1476 0.2001 0.008 0.1102 0.2288 0.4894 0.0033

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6004
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4034
Ophiocordyceps australis map64 (Brazil) OphauB2|3252
Ophiocordyceps camponoti-floridani Ophcf2|06666 (this protein)
Ophiocordyceps kimflemingae Ophio5|7466
Ophiocordyceps subramaniannii Hirsu2|10766

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06666
MSHQRYSSHDAIKEPHSVSVKVLRLSRPSLVAQYPIDRPLTSASASPEPTPASLACRTKTETKTAPFLLSPILKL
PVSFGSAYVGETFSCTLCVNNDLPVDTNKKICEVRMAAEMKTPGQMTAQELELRPGADDQVHDLDSGGTLQRVLS
FDLKEEGNHVLAVTVSYYEATETSGRTRTFRKLYQFICKPSLIVRTKIGSLGGRSWVLEAQLENCSDATVQLEKV
VMELDDGFAYADCNWEGSKPLLLPGAVEQACFVVVDERSDEERAGGGRLTFGTLGIGWRGQMGNRGFLSTGKLGT
RPR*
Coding >Ophcf2|06666
ATGAGCCACCAACGATACTCCTCACATGACGCAATCAAGGAGCCGCACAGCGTCTCCGTCAAAGTTCTCCGACTC
TCCCGGCCGTCACTGGTGGCGCAGTATCCAATCGACCGGCCGCTGACATCGGCATCGGCATCGCCGGAGCCCACA
CCGGCATCGCTCGCATGCCGGACCAAAACGGAGACGAAGACTGCGCCTTTCCTGCTCAGCCCCATCCTCAAGCTG
CCCGTGTCGTTCGGGTCGGCGTACGTGGGCGAGACGTTCAGCTGCACGCTCTGCGTCAACAATGACCTGCCCGTC
GACACGAACAAGAAGATCTGCGAGGTGCGCATGGCGGCGGAGATGAAGACGCCGGGACAGATGACGGCGCAGGAG
CTGGAGCTTCGGCCCGGCGCCGACGACCAAGTTCATGACCTCGACAGCGGCGGTACGCTGCAAAGGGTTCTCTCG
TTTGATCTCAAGGAGGAGGGAAATCACGTGCTGGCGGTGACGGTGAGCTACTACGAAGCGACGGAGACGAGCGGG
CGGACGCGCACGTTCCGCAAGCTCTACCAATTCATCTGCAAGCCGTCGCTCATCGTGCGGACTAAGATTGGCAGT
CTAGGCGGGCGAAGTTGGGTGCTGGAAGCGCAGCTGGAGAACTGCAGCGATGCGACGGTGCAGCTGGAGAAAGTG
GTCATGGAACTCGACGATGGCTTCGCCTACGCTGACTGCAACTGGGAGGGGTCCAAGCCGCTGCTGCTGCCGGGG
GCTGTCGAGCAGGCTTGCTTCGTTGTCGTTGATGAGCGGTCGGATGAGGAGAGGGCTGGCGGTGGGAGGCTGACG
TTTGGGACGCTTGGGATAGGTTGGAGGGGGCAGATGGGCAATCGGGGCTTTCTTTCGACGGGGAAGCTGGGGACG
AGGCCGAGGTGA
Transcript >Ophcf2|06666
ATGAGCCACCAACGATACTCCTCACATGACGCAATCAAGGAGCCGCACAGCGTCTCCGTCAAAGTTCTCCGACTC
TCCCGGCCGTCACTGGTGGCGCAGTATCCAATCGACCGGCCGCTGACATCGGCATCGGCATCGCCGGAGCCCACA
CCGGCATCGCTCGCATGCCGGACCAAAACGGAGACGAAGACTGCGCCTTTCCTGCTCAGCCCCATCCTCAAGCTG
CCCGTGTCGTTCGGGTCGGCGTACGTGGGCGAGACGTTCAGCTGCACGCTCTGCGTCAACAATGACCTGCCCGTC
GACACGAACAAGAAGATCTGCGAGGTGCGCATGGCGGCGGAGATGAAGACGCCGGGACAGATGACGGCGCAGGAG
CTGGAGCTTCGGCCCGGCGCCGACGACCAAGTTCATGACCTCGACAGCGGCGGTACGCTGCAAAGGGTTCTCTCG
TTTGATCTCAAGGAGGAGGGAAATCACGTGCTGGCGGTGACGGTGAGCTACTACGAAGCGACGGAGACGAGCGGG
CGGACGCGCACGTTCCGCAAGCTCTACCAATTCATCTGCAAGCCGTCGCTCATCGTGCGGACTAAGATTGGCAGT
CTAGGCGGGCGAAGTTGGGTGCTGGAAGCGCAGCTGGAGAACTGCAGCGATGCGACGGTGCAGCTGGAGAAAGTG
GTCATGGAACTCGACGATGGCTTCGCCTACGCTGACTGCAACTGGGAGGGGTCCAAGCCGCTGCTGCTGCCGGGG
GCTGTCGAGCAGGCTTGCTTCGTTGTCGTTGATGAGCGGTCGGATGAGGAGAGGGCTGGCGGTGGGAGGCTGACG
TTTGGGACGCTTGGGATAGGTTGGAGGGGGCAGATGGGCAATCGGGGCTTTCTTTCGACGGGGAAGCTGGGGACG
AGGCCGAGGTGA
Gene >Ophcf2|06666
ATGAGCCACCAACGATACTCCTCACATGACGCAATCAAGGAGCCGCACAGCGTCTCCGTCAAAGTTCTCCGGCAA
GTTCTCAGCAGACGAGACCGAGGGGCCCCGAGATGGATAACTGCGGCTGACCAGCGCAACACCAGACTCTCCCGG
CCGTCACTGGTGGCGCAGTATCCAATCGACCGGCCGCTGACATCGGCATCGGCATCGCCGGAGCCCACACCGGCA
TCGCTCGCATGCCGGACCAAAACGGAGACGAAGACTGCGCCTTTCCTGCTCAGCCCCATCCTCAAGCTGCCCGTG
TCGTTCGGGTCGGCGTACGTGGGCGAGACGTTCAGCTGCACGCTCTGCGTCAACAATGACCTGCCCGTCGACACG
AACAAGAAGATCTGCGAGGTGCGCATGGCGGCGGAGATGAAGACGCCGGGACAGATGACGGCGCAGGAGCTGGAG
CTTCGGCCCGGCGCCGACGACCAAGTTCATGACCTCGACAGCGGCGGTACGCTGCAAAGGGTTCTCTCGTTTGAT
CTCAAGGAGGAGGGAAATCACGTGCTGGCGGTGACGGTGAGCTACTACGAAGCGACGGAGACGAGCGGGCGGACG
CGCACGTTCCGCAAGCTCTACCAATTCATCTGCAAGCCGTCGCTCATCGTGCGGACTAAGATTGGCAGTCTAGGC
GGGCGAAGTTGGGTGCTGGAAGCGCAGCTGGAGAACTGCAGCGATGCGACGGTGCAGCTGGAGAAAGTGGTCATG
GAACTCGACGATGGCTTCGCCTACGCTGACTGCAACTGGGAGGGGTCCAAGCCGCTGCTGCTGCCGGGGGCTGTC
GAGCAGGCTTGCTTCGTTGTCGTTGATGAGCGGTCGGATGAGGAGAGGGCTGGCGGTGGGAGGCTGACGTTTGGG
ACGCTTGGGATAGGTTGGAGGGGGCAGATGGGCAATCGGGGCTTTCTTTCGACGGGGAAGCTGGGGACGAGGCCG
AGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail