Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06654
Gene name
Locationscaffold_08:717351..719888
Strand+
Gene length (bp)2537
Transcript length (bp)2475
Coding sequence length (bp)2475
Protein length (aa) 825

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13688 Reprolysin_5 Metallo-peptidase family M12 5.1E-56 286 493
PF13574 Reprolysin_2 Metallo-peptidase family M12B Reprolysin-like 3.1E-48 310 503
PF13583 Reprolysin_4 Metallo-peptidase family M12B Reprolysin-like 1.4E-46 286 502
PF00200 Disintegrin Disintegrin 7.7E-17 534 610
PF13582 Reprolysin_3 Metallo-peptidase family M12B Reprolysin-like 3.2E-09 314 450

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 717 739 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06654
MVALASLAAALASSVFVLLSSAHSIRRNPVAYVTLVDDAVIGSPSHRVHADSHFDLTFTLHDGRNRFRLALEPNH
DIVHDDFTISYLDSDGSVRETQTVPRSHHRVYRGHAFVERPDMQGWSKAGWARITVHRDGDRPIFEGTFRVDGNH
HNVVGARQYLKLRHERDPVLDADVDVDSMVVWRDSDVMDDDDDDDDDDMHAELKRDLSSSSNATTEQRCDAGSLR
YNMDKDNNYHDVDAASQSSNPLHFLEWRSLVARQNDVMGGGPLPGANLGNSIGSLDGCPTTKKVALVGIATDCTY
WDGFNSREEIRTSVINMVNQASQLYESTFKISIGIRNLTISDKNCPGTPPASAPWNIGCGDQFTITDRLNAFSHW
RGQLSDNNAYWTLLTRCATGSAVGLAWRGQLCRVGLDSNRDTNETVASANVVVRTDTEWQIFAHESGHMFGASHD
CTRASCAMAGGGEMCCPLSRSSCNAEGKFIMNPTTGKDITQFSPCSIGNICSGFKTNLVKASCLTDNKDVKTITD
SQCGNGIVESGEDCDCGGEQGCRGNRCCDAKTCKFTSGSVCDPANEDCCGRDCRFAAKGTVCRASTGVCDLAEVC
TGDGAGCPADHHNNDGDSCGDGLNCASGQCTSRDMQCRAVASSLRGLNTTQACPGSGCSLSCLSADTGLDSCITL
NQNFLDGSLCGGGGKCVDGQCKGASTLKEIGSWLHDHKAILIPVISIIGGLIVVAIITSVIGSLRRRIRRRNMIQ
AAKESSAWPSDASRASPHPTRQPGPLRQWSDSMASNEALYTGHGHPQWPLAPPPPSYERPSQEALRRTRSERYA*
Coding >Ophcf2|06654
ATGGTTGCTCTCGCCTCTCTCGCTGCCGCTCTAGCCAGCTCCGTCTTTGTGCTGCTGTCGTCCGCTCACTCGATT
CGGCGCAATCCCGTCGCCTACGTTACGCTCGTCGACGACGCCGTCATCGGCTCACCCTCACATCGAGTACACGCC
GACTCCCATTTCGATCTCACCTTTACTCTACACGATGGACGTAATCGCTTCCGGCTGGCACTCGAACCCAACCAC
GATATTGTTCACGACGACTTTACTATCAGCTACCTCGACTCCGACGGCTCGGTCCGCGAGACGCAGACGGTCCCA
AGGAGCCACCATCGCGTCTACCGCGGCCATGCCTTTGTTGAACGGCCCGACATGCAGGGCTGGTCAAAGGCCGGC
TGGGCCCGCATCACTGTTCATCGCGACGGGGACCGTCCCATCTTCGAGGGCACCTTTCGCGTCGACGGGAACCAC
CACAACGTTGTTGGCGCTCGACAATACCTGAAGCTCCGCCATGAGCGGGACCCTGTCCTCGACGCCGACGTCGAC
GTCGATTCCATGGTCGTTTGGCGCGATTCCGATGTGATGGATGACGACGACGACGACGACGACGACGACATGCAC
GCCGAGCTGAAGCGCGACCTATCTTCCTCGTCAAACGCGACGACCGAACAGCGGTGCGATGCCGGCTCCCTCCGG
TATAACATGGACAAAGACAACAACTACCATGACGTCGACGCCGCCAGTCAGAGCTCCAACCCGCTACACTTTCTC
GAGTGGCGCTCCCTGGTGGCGCGGCAAAACGATGTCATGGGCGGCGGCCCCTTACCGGGCGCCAACCTCGGGAAC
TCGATCGGCTCCCTCGACGGCTGCCCTACGACGAAAAAGGTGGCACTGGTCGGCATCGCCACCGACTGCACCTAC
TGGGACGGCTTCAACAGCAGGGAGGAGATAAGAACGAGCGTCATCAACATGGTCAACCAGGCGTCGCAGCTGTAC
GAGAGCACCTTTAAGATCTCCATCGGCATCCGCAACCTCACCATCAGCGACAAGAACTGTCCCGGCACGCCGCCC
GCGTCGGCGCCGTGGAACATTGGCTGCGGCGACCAGTTCACCATCACGGACCGGCTCAACGCCTTCTCCCACTGG
CGCGGGCAGCTCAGCGACAACAACGCCTACTGGACCCTGCTGACCAGATGCGCGACGGGCTCGGCCGTCGGACTG
GCCTGGCGCGGTCAACTGTGTCGCGTCGGCCTCGACAGCAACAGGGACACCAACGAGACGGTGGCGTCGGCCAAC
GTCGTCGTCCGCACCGACACGGAGTGGCAGATCTTCGCGCACGAGAGCGGCCACATGTTCGGCGCGTCGCACGAC
TGCACCAGGGCCTCGTGCGCCATGGCGGGCGGCGGCGAGATGTGCTGCCCGCTGAGCCGCTCCAGCTGCAACGCC
GAGGGGAAATTCATCATGAACCCGACTACGGGCAAGGACATTACTCAGTTCTCGCCCTGCAGCATCGGTAACATC
TGCTCGGGCTTCAAGACCAACCTGGTCAAGGCCAGCTGCCTGACGGACAACAAGGACGTCAAGACGATCACGGAC
AGCCAGTGCGGCAACGGCATCGTCGAGAGCGGAGAGGACTGCGACTGCGGCGGCGAACAGGGCTGTCGCGGCAAT
CGCTGCTGCGACGCCAAGACGTGCAAGTTCACCTCGGGCTCCGTCTGCGATCCGGCCAACGAGGACTGCTGCGGC
CGGGACTGTCGGTTCGCGGCAAAGGGGACCGTCTGTCGCGCCAGCACGGGCGTCTGCGACCTGGCCGAGGTCTGC
ACCGGCGACGGCGCCGGATGTCCGGCCGATCATCACAACAACGACGGCGACTCGTGCGGCGACGGGCTCAACTGC
GCCTCGGGTCAATGCACCTCGCGCGACATGCAGTGCCGCGCCGTCGCCAGCAGCCTGAGAGGTCTCAACACCACC
CAGGCCTGTCCGGGCAGCGGCTGCTCGCTGTCGTGTCTGTCGGCCGACACGGGGCTCGACTCGTGCATCACCCTC
AACCAGAACTTCCTCGACGGCTCCCTCTGCGGCGGCGGCGGGAAGTGCGTCGACGGTCAGTGCAAGGGAGCCTCG
ACGCTCAAGGAGATCGGCTCATGGCTCCACGACCACAAGGCCATCCTGATACCCGTCATCTCCATCATCGGCGGC
CTCATCGTCGTCGCAATCATCACCTCCGTCATCGGCAGCCTCCGCCGCCGCATCCGCCGCCGCAACATGATACAG
GCCGCAAAGGAATCATCGGCCTGGCCTTCGGACGCATCCCGCGCCTCCCCGCACCCGACGAGGCAGCCCGGGCCC
CTCCGCCAATGGAGCGACTCCATGGCCTCCAACGAGGCTCTCTATACCGGCCATGGTCATCCGCAGTGGCCTCTC
GCCCCGCCGCCGCCGTCGTACGAGCGACCGAGTCAGGAGGCCTTGCGGCGGACTCGAAGCGAGCGATATGCATAG
Transcript >Ophcf2|06654
ATGGTTGCTCTCGCCTCTCTCGCTGCCGCTCTAGCCAGCTCCGTCTTTGTGCTGCTGTCGTCCGCTCACTCGATT
CGGCGCAATCCCGTCGCCTACGTTACGCTCGTCGACGACGCCGTCATCGGCTCACCCTCACATCGAGTACACGCC
GACTCCCATTTCGATCTCACCTTTACTCTACACGATGGACGTAATCGCTTCCGGCTGGCACTCGAACCCAACCAC
GATATTGTTCACGACGACTTTACTATCAGCTACCTCGACTCCGACGGCTCGGTCCGCGAGACGCAGACGGTCCCA
AGGAGCCACCATCGCGTCTACCGCGGCCATGCCTTTGTTGAACGGCCCGACATGCAGGGCTGGTCAAAGGCCGGC
TGGGCCCGCATCACTGTTCATCGCGACGGGGACCGTCCCATCTTCGAGGGCACCTTTCGCGTCGACGGGAACCAC
CACAACGTTGTTGGCGCTCGACAATACCTGAAGCTCCGCCATGAGCGGGACCCTGTCCTCGACGCCGACGTCGAC
GTCGATTCCATGGTCGTTTGGCGCGATTCCGATGTGATGGATGACGACGACGACGACGACGACGACGACATGCAC
GCCGAGCTGAAGCGCGACCTATCTTCCTCGTCAAACGCGACGACCGAACAGCGGTGCGATGCCGGCTCCCTCCGG
TATAACATGGACAAAGACAACAACTACCATGACGTCGACGCCGCCAGTCAGAGCTCCAACCCGCTACACTTTCTC
GAGTGGCGCTCCCTGGTGGCGCGGCAAAACGATGTCATGGGCGGCGGCCCCTTACCGGGCGCCAACCTCGGGAAC
TCGATCGGCTCCCTCGACGGCTGCCCTACGACGAAAAAGGTGGCACTGGTCGGCATCGCCACCGACTGCACCTAC
TGGGACGGCTTCAACAGCAGGGAGGAGATAAGAACGAGCGTCATCAACATGGTCAACCAGGCGTCGCAGCTGTAC
GAGAGCACCTTTAAGATCTCCATCGGCATCCGCAACCTCACCATCAGCGACAAGAACTGTCCCGGCACGCCGCCC
GCGTCGGCGCCGTGGAACATTGGCTGCGGCGACCAGTTCACCATCACGGACCGGCTCAACGCCTTCTCCCACTGG
CGCGGGCAGCTCAGCGACAACAACGCCTACTGGACCCTGCTGACCAGATGCGCGACGGGCTCGGCCGTCGGACTG
GCCTGGCGCGGTCAACTGTGTCGCGTCGGCCTCGACAGCAACAGGGACACCAACGAGACGGTGGCGTCGGCCAAC
GTCGTCGTCCGCACCGACACGGAGTGGCAGATCTTCGCGCACGAGAGCGGCCACATGTTCGGCGCGTCGCACGAC
TGCACCAGGGCCTCGTGCGCCATGGCGGGCGGCGGCGAGATGTGCTGCCCGCTGAGCCGCTCCAGCTGCAACGCC
GAGGGGAAATTCATCATGAACCCGACTACGGGCAAGGACATTACTCAGTTCTCGCCCTGCAGCATCGGTAACATC
TGCTCGGGCTTCAAGACCAACCTGGTCAAGGCCAGCTGCCTGACGGACAACAAGGACGTCAAGACGATCACGGAC
AGCCAGTGCGGCAACGGCATCGTCGAGAGCGGAGAGGACTGCGACTGCGGCGGCGAACAGGGCTGTCGCGGCAAT
CGCTGCTGCGACGCCAAGACGTGCAAGTTCACCTCGGGCTCCGTCTGCGATCCGGCCAACGAGGACTGCTGCGGC
CGGGACTGTCGGTTCGCGGCAAAGGGGACCGTCTGTCGCGCCAGCACGGGCGTCTGCGACCTGGCCGAGGTCTGC
ACCGGCGACGGCGCCGGATGTCCGGCCGATCATCACAACAACGACGGCGACTCGTGCGGCGACGGGCTCAACTGC
GCCTCGGGTCAATGCACCTCGCGCGACATGCAGTGCCGCGCCGTCGCCAGCAGCCTGAGAGGTCTCAACACCACC
CAGGCCTGTCCGGGCAGCGGCTGCTCGCTGTCGTGTCTGTCGGCCGACACGGGGCTCGACTCGTGCATCACCCTC
AACCAGAACTTCCTCGACGGCTCCCTCTGCGGCGGCGGCGGGAAGTGCGTCGACGGTCAGTGCAAGGGAGCCTCG
ACGCTCAAGGAGATCGGCTCATGGCTCCACGACCACAAGGCCATCCTGATACCCGTCATCTCCATCATCGGCGGC
CTCATCGTCGTCGCAATCATCACCTCCGTCATCGGCAGCCTCCGCCGCCGCATCCGCCGCCGCAACATGATACAG
GCCGCAAAGGAATCATCGGCCTGGCCTTCGGACGCATCCCGCGCCTCCCCGCACCCGACGAGGCAGCCCGGGCCC
CTCCGCCAATGGAGCGACTCCATGGCCTCCAACGAGGCTCTCTATACCGGCCATGGTCATCCGCAGTGGCCTCTC
GCCCCGCCGCCGCCGTCGTACGAGCGACCGAGTCAGGAGGCCTTGCGGCGGACTCGAAGCGAGCGATATGCATAG
Gene >Ophcf2|06654
ATGGTTGCTCTCGCCTCTCTCGCTGCCGCTCTAGCCAGCTCCGTCTTTGTGCTGCTGTCGTCCGGTAAGATATGA
TGTTTTGATTTGAACATGATTGAAAATGAGGCCTTCTGACGGGCTGCTCAGCTCACTCGATTCGGCGCAATCCCG
TCGCCTACGTTACGCTCGTCGACGACGCCGTCATCGGCTCACCCTCACATCGAGTACACGCCGACTCCCATTTCG
ATCTCACCTTTACTCTACACGATGGACGTAATCGCTTCCGGCTGGCACTCGAACCCAACCACGATATTGTTCACG
ACGACTTTACTATCAGCTACCTCGACTCCGACGGCTCGGTCCGCGAGACGCAGACGGTCCCAAGGAGCCACCATC
GCGTCTACCGCGGCCATGCCTTTGTTGAACGGCCCGACATGCAGGGCTGGTCAAAGGCCGGCTGGGCCCGCATCA
CTGTTCATCGCGACGGGGACCGTCCCATCTTCGAGGGCACCTTTCGCGTCGACGGGAACCACCACAACGTTGTTG
GCGCTCGACAATACCTGAAGCTCCGCCATGAGCGGGACCCTGTCCTCGACGCCGACGTCGACGTCGATTCCATGG
TCGTTTGGCGCGATTCCGATGTGATGGATGACGACGACGACGACGACGACGACGACATGCACGCCGAGCTGAAGC
GCGACCTATCTTCCTCGTCAAACGCGACGACCGAACAGCGGTGCGATGCCGGCTCCCTCCGGTATAACATGGACA
AAGACAACAACTACCATGACGTCGACGCCGCCAGTCAGAGCTCCAACCCGCTACACTTTCTCGAGTGGCGCTCCC
TGGTGGCGCGGCAAAACGATGTCATGGGCGGCGGCCCCTTACCGGGCGCCAACCTCGGGAACTCGATCGGCTCCC
TCGACGGCTGCCCTACGACGAAAAAGGTGGCACTGGTCGGCATCGCCACCGACTGCACCTACTGGGACGGCTTCA
ACAGCAGGGAGGAGATAAGAACGAGCGTCATCAACATGGTCAACCAGGCGTCGCAGCTGTACGAGAGCACCTTTA
AGATCTCCATCGGCATCCGCAACCTCACCATCAGCGACAAGAACTGTCCCGGCACGCCGCCCGCGTCGGCGCCGT
GGAACATTGGCTGCGGCGACCAGTTCACCATCACGGACCGGCTCAACGCCTTCTCCCACTGGCGCGGGCAGCTCA
GCGACAACAACGCCTACTGGACCCTGCTGACCAGATGCGCGACGGGCTCGGCCGTCGGACTGGCCTGGCGCGGTC
AACTGTGTCGCGTCGGCCTCGACAGCAACAGGGACACCAACGAGACGGTGGCGTCGGCCAACGTCGTCGTCCGCA
CCGACACGGAGTGGCAGATCTTCGCGCACGAGAGCGGCCACATGTTCGGCGCGTCGCACGACTGCACCAGGGCCT
CGTGCGCCATGGCGGGCGGCGGCGAGATGTGCTGCCCGCTGAGCCGCTCCAGCTGCAACGCCGAGGGGAAATTCA
TCATGAACCCGACTACGGGCAAGGACATTACTCAGTTCTCGCCCTGCAGCATCGGTAACATCTGCTCGGGCTTCA
AGACCAACCTGGTCAAGGCCAGCTGCCTGACGGACAACAAGGACGTCAAGACGATCACGGACAGCCAGTGCGGCA
ACGGCATCGTCGAGAGCGGAGAGGACTGCGACTGCGGCGGCGAACAGGGCTGTCGCGGCAATCGCTGCTGCGACG
CCAAGACGTGCAAGTTCACCTCGGGCTCCGTCTGCGATCCGGCCAACGAGGACTGCTGCGGCCGGGACTGTCGGT
TCGCGGCAAAGGGGACCGTCTGTCGCGCCAGCACGGGCGTCTGCGACCTGGCCGAGGTCTGCACCGGCGACGGCG
CCGGATGTCCGGCCGATCATCACAACAACGACGGCGACTCGTGCGGCGACGGGCTCAACTGCGCCTCGGGTCAAT
GCACCTCGCGCGACATGCAGTGCCGCGCCGTCGCCAGCAGCCTGAGAGGTCTCAACACCACCCAGGCCTGTCCGG
GCAGCGGCTGCTCGCTGTCGTGTCTGTCGGCCGACACGGGGCTCGACTCGTGCATCACCCTCAACCAGAACTTCC
TCGACGGCTCCCTCTGCGGCGGCGGCGGGAAGTGCGTCGACGGTCAGTGCAAGGGAGCCTCGACGCTCAAGGAGA
TCGGCTCATGGCTCCACGACCACAAGGCCATCCTGATACCCGTCATCTCCATCATCGGCGGCCTCATCGTCGTCG
CAATCATCACCTCCGTCATCGGCAGCCTCCGCCGCCGCATCCGCCGCCGCAACATGATACAGGCCGCAAAGGAAT
CATCGGCCTGGCCTTCGGACGCATCCCGCGCCTCCCCGCACCCGACGAGGCAGCCCGGGCCCCTCCGCCAATGGA
GCGACTCCATGGCCTCCAACGAGGCTCTCTATACCGGCCATGGTCATCCGCAGTGGCCTCTCGCCCCGCCGCCGC
CGTCGTACGAGCGACCGAGTCAGGAGGCCTTGCGGCGGACTCGAAGCGAGCGATATGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail