Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06641
Gene name
Locationscaffold_08:680529..684040
Strand-
Gene length (bp)3511
Transcript length (bp)3042
Coding sequence length (bp)3042
Protein length (aa) 1014

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03200 Glyco_hydro_63 Glycosyl hydrolase family 63 C-terminal domain 6.9E-06 720 809

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5392 0.2765 0.068 0.0748 0.0493 0.0062 0.2562 0.1647 0.2747 0.0235

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2749
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3522
Ophiocordyceps australis map64 (Brazil) OphauB2|6534
Ophiocordyceps camponoti-floridani Ophcf2|06641 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4075
Ophiocordyceps kimflemingae Ophio5|5288
Ophiocordyceps subramaniannii Hirsu2|4345

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06641
MVAFTYITDEEKRLKDDRDRVKYWKKWGPYVAERQWATVREDYSADGDAWSHFPHSHARSRAFRWGEDGIAGVSD
THGFENIAFGFWNEKDDILKERLYGLSNPQGNHGESVKEAYFHLDNTPHSYMKFLYKYPQAKFPYQDLREENAKR
TKQEREYQITDTGVFDQDRYWDIFIETAKEADDPDELLFRVTAWNRGPEPAPLHIIPQLWFRNTWSWGRESQDKK
PSIRKHAAMAVKSDHYSLGRRFFVLSPSPGVGSSEEDVIPDLLFTENDTNFNTLYGQENKQPYVKDAFHRHIIDG
VKSAINPAKTGTKCAAWFSFTENGGVEPGECAVVRFRFSRRDMAFIDEEEFDNIMDRRREEADEFYFKISPLPMT
DDLRNIQRQAFAGMMWTKQHYHFVWDQWAKGDPAMPPPPPNRIGLRNDQWKHMHCDDILSMPDSWEYPFFAAWDS
AFHCIPLAMIDPDFAKKQLDLFTREWYCHPNGQLPAYEWNFSDVNPPVHAWATFRVFKIERKMYGRQDLDFLERV
FHKLLLNFTWWVNRKDANSKNIFEGGFLGLDNIGLFNRSEPLPTGGVLEQADSTGWMGFFCLSMLNISLELAKHR
RIYEDIASKFFEHFILISDAMTFRAGQKSEQSLWNEEDGFYYDAISWGGPWVQQLPVRSLVGLIPLYATATLEPE
LINKLPSFRKRVEWFVANRCDLAERNMASIRKRGKGDRILLSIVSKDRLEKILKRMLDEDEFLSGHGIRSLSKYH
RDHPYSMEVNGQKFTVGYVPGDSDSGLFGGNSNWRGPIWLCVNFLLVESLQRFYLFYGPDFRVECPTGSGEYMHL
GRVSEEIQHRLQHLFIRTEEGRRSVNGGDNRLDFDEHWRNYMWFHEFFDGNSGRGLGASHQCGWTGLIARVIHDT
GVNCRLPQTPRTPSIGMAHYFDDVFHRAVDPGTPTARRHRRSSTARSIGARSDFDANGLDESVLSLGSDHAEGRQ
RERAEADSHLHRYVADQLSDYMKREGEYQHEDEFETQA*
Coding >Ophcf2|06641
ATGGTCGCTTTCACGTACATCACCGATGAAGAGAAACGCCTCAAAGACGATCGGGACCGCGTCAAGTACTGGAAG
AAATGGGGTCCCTACGTTGCCGAGCGGCAATGGGCCACGGTGCGTGAAGACTACAGCGCCGACGGAGATGCCTGG
AGCCACTTTCCGCATAGTCACGCCCGCTCGCGTGCTTTCAGATGGGGCGAGGATGGCATTGCTGGTGTTTCCGAC
ACGCACGGCTTCGAGAACATTGCCTTTGGCTTCTGGAACGAGAAAGACGACATTCTGAAAGAGAGGCTCTACGGC
CTGTCCAACCCGCAGGGGAACCATGGCGAGAGCGTCAAAGAGGCCTACTTTCATCTCGACAACACTCCACACTCG
TACATGAAGTTTCTCTACAAGTATCCCCAGGCCAAGTTTCCCTATCAAGACCTTCGCGAGGAAAATGCCAAGAGG
ACCAAACAAGAACGGGAGTACCAAATCACCGACACAGGCGTCTTCGACCAAGATCGCTACTGGGACATCTTCATC
GAGACGGCAAAGGAGGCGGACGATCCTGACGAGCTTCTCTTCCGAGTCACGGCGTGGAACAGAGGCCCGGAACCT
GCGCCCCTTCACATTATACCGCAACTATGGTTCCGCAACACCTGGAGCTGGGGTCGCGAATCTCAAGACAAGAAG
CCCTCTATTCGCAAGCACGCGGCCATGGCCGTCAAGTCTGACCACTATAGTCTCGGCCGCCGTTTCTTCGTTCTG
TCTCCGTCTCCCGGCGTAGGGTCGAGCGAGGAAGATGTCATACCCGATCTCCTGTTTACCGAAAACGACACCAAC
TTCAATACGCTCTACGGCCAGGAGAACAAGCAGCCCTACGTCAAGGATGCCTTCCACCGCCACATCATCGACGGC
GTCAAGAGTGCAATCAATCCAGCCAAGACGGGCACCAAATGTGCTGCTTGGTTCAGCTTCACCGAGAACGGGGGT
GTCGAACCGGGCGAGTGTGCTGTCGTTCGTTTCCGCTTCTCCAGGAGGGACATGGCCTTTATTGATGAGGAAGAG
TTCGACAACATCATGGATCGGCGAAGGGAAGAGGCAGACGAGTTCTACTTCAAAATCAGCCCCCTACCGATGACT
GACGATCTGCGTAATATTCAGAGACAGGCATTCGCGGGCATGATGTGGACGAAGCAGCACTACCACTTCGTATGG
GACCAATGGGCCAAAGGCGATCCTGCCATGCCTCCTCCGCCCCCAAATCGAATAGGGCTACGAAACGACCAGTGG
AAACATATGCACTGCGACGACATTCTGTCCATGCCCGACTCCTGGGAGTATCCCTTCTTCGCCGCTTGGGACAGC
GCCTTTCACTGCATTCCCCTGGCCATGATCGATCCCGACTTTGCCAAGAAGCAGCTGGACCTTTTTACTCGGGAG
TGGTACTGCCATCCCAACGGACAGCTTCCTGCATACGAGTGGAACTTTAGCGACGTGAACCCTCCAGTTCACGCC
TGGGCAACGTTCAGGGTGTTTAAGATTGAGCGCAAGATGTACGGCCGACAGGACCTGGACTTTCTTGAACGCGTC
TTTCACAAACTGCTTCTCAACTTCACCTGGTGGGTGAATCGAAAGGACGCAAACAGCAAGAACATCTTCGAGGGC
GGCTTCTTGGGGCTGGACAACATTGGCCTGTTCAACCGATCCGAGCCCTTGCCGACGGGAGGCGTGCTGGAGCAG
GCAGATAGTACGGGATGGATGGGTTTCTTTTGTCTGTCGATGCTCAACATTTCTCTGGAGCTGGCCAAGCATCGC
CGTATCTACGAGGACATTGCGTCCAAGTTCTTTGAGCACTTTATCCTCATCAGCGACGCCATGACCTTCAGGGCC
GGCCAGAAGAGCGAGCAGTCGCTGTGGAACGAAGAAGACGGCTTCTACTACGACGCCATCTCGTGGGGAGGGCCT
TGGGTGCAGCAGCTGCCCGTGAGGTCGCTGGTGGGCTTGATTCCGCTGTACGCCACGGCCACGCTGGAGCCGGAG
CTGATCAACAAGCTCCCTTCGTTCCGGAAGAGGGTCGAGTGGTTCGTCGCCAACCGATGCGACCTGGCAGAGAGA
AACATGGCCAGCATCCGGAAGAGAGGCAAGGGAGACCGCATCCTCCTTTCCATTGTCAGCAAGGACAGGCTGGAG
AAGATTCTCAAGCGGATGCTGGACGAGGACGAGTTTCTCAGCGGTCACGGCATCCGATCGCTGTCCAAGTACCAC
CGGGACCACCCATACTCGATGGAAGTCAACGGGCAAAAGTTTACGGTTGGATACGTGCCCGGTGACTCAGACAGC
GGGCTCTTTGGCGGCAACAGCAACTGGAGGGGTCCCATATGGCTGTGTGTCAACTTTCTTCTGGTCGAGTCGCTG
CAGCGTTTCTACCTGTTTTACGGGCCGGACTTCAGGGTCGAGTGCCCGACGGGCAGCGGGGAGTACATGCATTTG
GGCCGAGTTTCGGAGGAGATTCAGCACCGGCTTCAGCACCTTTTTATCCGGACCGAAGAGGGCAGGCGGAGCGTC
AACGGCGGCGACAATCGGCTGGACTTTGACGAGCACTGGAGGAACTACATGTGGTTCCACGAGTTCTTTGACGGC
AACTCGGGACGGGGCCTCGGGGCCAGCCATCAATGCGGCTGGACGGGTCTGATTGCGCGTGTGATACACGATACG
GGGGTCAACTGCCGGCTTCCACAGACGCCACGGACGCCGTCCATCGGCATGGCGCATTACTTCGACGACGTGTTC
CACCGAGCCGTCGACCCGGGGACCCCGACGGCGCGGCGGCACAGGCGATCGTCGACGGCGCGGTCCATCGGGGCA
CGCAGCGACTTTGACGCCAACGGGCTGGACGAGAGCGTCTTGAGCCTCGGATCGGATCACGCCGAGGGACGGCAA
AGAGAGAGGGCCGAGGCGGACTCGCACCTCCACCGATACGTGGCGGACCAGCTCAGCGACTACATGAAGCGGGAG
GGAGAGTACCAGCACGAAGACGAGTTTGAGACGCAGGCCTGA
Transcript >Ophcf2|06641
ATGGTCGCTTTCACGTACATCACCGATGAAGAGAAACGCCTCAAAGACGATCGGGACCGCGTCAAGTACTGGAAG
AAATGGGGTCCCTACGTTGCCGAGCGGCAATGGGCCACGGTGCGTGAAGACTACAGCGCCGACGGAGATGCCTGG
AGCCACTTTCCGCATAGTCACGCCCGCTCGCGTGCTTTCAGATGGGGCGAGGATGGCATTGCTGGTGTTTCCGAC
ACGCACGGCTTCGAGAACATTGCCTTTGGCTTCTGGAACGAGAAAGACGACATTCTGAAAGAGAGGCTCTACGGC
CTGTCCAACCCGCAGGGGAACCATGGCGAGAGCGTCAAAGAGGCCTACTTTCATCTCGACAACACTCCACACTCG
TACATGAAGTTTCTCTACAAGTATCCCCAGGCCAAGTTTCCCTATCAAGACCTTCGCGAGGAAAATGCCAAGAGG
ACCAAACAAGAACGGGAGTACCAAATCACCGACACAGGCGTCTTCGACCAAGATCGCTACTGGGACATCTTCATC
GAGACGGCAAAGGAGGCGGACGATCCTGACGAGCTTCTCTTCCGAGTCACGGCGTGGAACAGAGGCCCGGAACCT
GCGCCCCTTCACATTATACCGCAACTATGGTTCCGCAACACCTGGAGCTGGGGTCGCGAATCTCAAGACAAGAAG
CCCTCTATTCGCAAGCACGCGGCCATGGCCGTCAAGTCTGACCACTATAGTCTCGGCCGCCGTTTCTTCGTTCTG
TCTCCGTCTCCCGGCGTAGGGTCGAGCGAGGAAGATGTCATACCCGATCTCCTGTTTACCGAAAACGACACCAAC
TTCAATACGCTCTACGGCCAGGAGAACAAGCAGCCCTACGTCAAGGATGCCTTCCACCGCCACATCATCGACGGC
GTCAAGAGTGCAATCAATCCAGCCAAGACGGGCACCAAATGTGCTGCTTGGTTCAGCTTCACCGAGAACGGGGGT
GTCGAACCGGGCGAGTGTGCTGTCGTTCGTTTCCGCTTCTCCAGGAGGGACATGGCCTTTATTGATGAGGAAGAG
TTCGACAACATCATGGATCGGCGAAGGGAAGAGGCAGACGAGTTCTACTTCAAAATCAGCCCCCTACCGATGACT
GACGATCTGCGTAATATTCAGAGACAGGCATTCGCGGGCATGATGTGGACGAAGCAGCACTACCACTTCGTATGG
GACCAATGGGCCAAAGGCGATCCTGCCATGCCTCCTCCGCCCCCAAATCGAATAGGGCTACGAAACGACCAGTGG
AAACATATGCACTGCGACGACATTCTGTCCATGCCCGACTCCTGGGAGTATCCCTTCTTCGCCGCTTGGGACAGC
GCCTTTCACTGCATTCCCCTGGCCATGATCGATCCCGACTTTGCCAAGAAGCAGCTGGACCTTTTTACTCGGGAG
TGGTACTGCCATCCCAACGGACAGCTTCCTGCATACGAGTGGAACTTTAGCGACGTGAACCCTCCAGTTCACGCC
TGGGCAACGTTCAGGGTGTTTAAGATTGAGCGCAAGATGTACGGCCGACAGGACCTGGACTTTCTTGAACGCGTC
TTTCACAAACTGCTTCTCAACTTCACCTGGTGGGTGAATCGAAAGGACGCAAACAGCAAGAACATCTTCGAGGGC
GGCTTCTTGGGGCTGGACAACATTGGCCTGTTCAACCGATCCGAGCCCTTGCCGACGGGAGGCGTGCTGGAGCAG
GCAGATAGTACGGGATGGATGGGTTTCTTTTGTCTGTCGATGCTCAACATTTCTCTGGAGCTGGCCAAGCATCGC
CGTATCTACGAGGACATTGCGTCCAAGTTCTTTGAGCACTTTATCCTCATCAGCGACGCCATGACCTTCAGGGCC
GGCCAGAAGAGCGAGCAGTCGCTGTGGAACGAAGAAGACGGCTTCTACTACGACGCCATCTCGTGGGGAGGGCCT
TGGGTGCAGCAGCTGCCCGTGAGGTCGCTGGTGGGCTTGATTCCGCTGTACGCCACGGCCACGCTGGAGCCGGAG
CTGATCAACAAGCTCCCTTCGTTCCGGAAGAGGGTCGAGTGGTTCGTCGCCAACCGATGCGACCTGGCAGAGAGA
AACATGGCCAGCATCCGGAAGAGAGGCAAGGGAGACCGCATCCTCCTTTCCATTGTCAGCAAGGACAGGCTGGAG
AAGATTCTCAAGCGGATGCTGGACGAGGACGAGTTTCTCAGCGGTCACGGCATCCGATCGCTGTCCAAGTACCAC
CGGGACCACCCATACTCGATGGAAGTCAACGGGCAAAAGTTTACGGTTGGATACGTGCCCGGTGACTCAGACAGC
GGGCTCTTTGGCGGCAACAGCAACTGGAGGGGTCCCATATGGCTGTGTGTCAACTTTCTTCTGGTCGAGTCGCTG
CAGCGTTTCTACCTGTTTTACGGGCCGGACTTCAGGGTCGAGTGCCCGACGGGCAGCGGGGAGTACATGCATTTG
GGCCGAGTTTCGGAGGAGATTCAGCACCGGCTTCAGCACCTTTTTATCCGGACCGAAGAGGGCAGGCGGAGCGTC
AACGGCGGCGACAATCGGCTGGACTTTGACGAGCACTGGAGGAACTACATGTGGTTCCACGAGTTCTTTGACGGC
AACTCGGGACGGGGCCTCGGGGCCAGCCATCAATGCGGCTGGACGGGTCTGATTGCGCGTGTGATACACGATACG
GGGGTCAACTGCCGGCTTCCACAGACGCCACGGACGCCGTCCATCGGCATGGCGCATTACTTCGACGACGTGTTC
CACCGAGCCGTCGACCCGGGGACCCCGACGGCGCGGCGGCACAGGCGATCGTCGACGGCGCGGTCCATCGGGGCA
CGCAGCGACTTTGACGCCAACGGGCTGGACGAGAGCGTCTTGAGCCTCGGATCGGATCACGCCGAGGGACGGCAA
AGAGAGAGGGCCGAGGCGGACTCGCACCTCCACCGATACGTGGCGGACCAGCTCAGCGACTACATGAAGCGGGAG
GGAGAGTACCAGCACGAAGACGAGTTTGAGACGCAGGCCTGA
Gene >Ophcf2|06641
ATGGTCGCTTTCACGTACATCACCGATGAAGAGAAACGCCTCAAAGACGATCGGGACCGCGTCAAGTACTGGAAG
AAATGGGGTCCCTACGTTGCCGAGCGGCAATGGGCCACGGGTGATTATTCTCGTCAAGCATCGACTCTCAACGCG
CGGCTGACGGCATTGCAGTGCGTGAAGACTACAGCGCCGACGGAGATGCCTGGAGCCGTATGCTTCTCTTCTTTT
CTCGTCTCGCGTCCACCAGTTTGGATTGACGTTTTTTTGCAGACTTTCCGCATAGTCACGCCCGCTCGCGTGCTT
TCAGATGGGGCGAGGATGGCATTGCTGGTGTTTCCGACACGCACGGCTTCGAGAACATTGCCTTTGGCTTCTGGA
ACGAGAAAGAGTCCGTCTTATATTCACTTTTGGAAAAACCCTGTTGATCTGATTCGTCTTAGCGACATTCTGAAA
GAGAGGCTCTACGGCCTGTCCAACCCGCAGGGGAACCATGGCGAGAGCGTCAAAGAGGCCTACTTTCATCTCGAC
AACACTCCAGTCCGTCCATCCCCGCTTTCTTCCCGTGGCAAGCCTGCCGACTAACCCACATCGATAGACCGTATG
ACTGCGATTGCTCCCCCCTTCCACCTTCGTCGGCTCTTCGCCCACGGTGCTAATATCTCACAGCACTCGTACATG
AAGTTTCTCTACAAGTATCCCCAGGCCAAGTTTCCCTATCAAGACCTTCGCGAGGAAAATGCCAAGAGGACCAAA
CAAGAACGGGAGTACCAAATCACCGACACAGGCGTCTTCGACCAAGATCGCTACTGGGACATCTTCATCGAGACG
GCAAAGGAGGCGGACGATCCTGACGAGCTTCTCTTCCGAGTCACGGCGTGGAACAGAGGCCCGGAACCTGCGCCC
CTTCACATTATACCGCAACTATGGTTCCGCAACACCTGGAGCTGGGGTCGCGAATCTCAAGACAAGAAGCCCTCT
ATTCGCAAGCACGCGGCCATGGCCGTCAAGTCTGACCACTATAGTCTCGGCCGCCGTTTCTTCGTTCTGTCTCCG
TCTCCCGGCGTAGGGTCGAGCGAGGAAGATGTCATACCCGATCTCCTGTTTACCGAAAACGACACCAACTTCAAT
ACGCTCTACGGCCAGGAGAACAAGCAGCCCTACGTCAAGGATGCCTTCCACCGCCACATCATCGACGGCGTCAAG
AGTGCAATCAATCCAGCCAAGACGGGCACCAAATGTGCTGCTTGGTTCAGCTTCACCGAGAACGGGGGTGTCGAA
CCGGGCGAGTGTGCTGGTATGGTCTCCCAGTCTGTTTCACCGCAGCGGCTTTTTCTGACGGGCCGTTCTAGTCGT
TCGTTTCCGCTTCTCCAGGAGGGACATGGCCTTTATTGATGAGGAAGAGTTCGACAACATCATGGATCGGCGAAG
GGAAGAGGCAGACGAGTTCTACTTCAAAATCAGCCCCCTACCGATGACTGACGATCTGCGTAATATTCAGAGACA
GGCATTCGCGGGCATGATGTGGACGAAGCAGCACTACCACTTCGTATGGGACCAATGGGCCAAAGGCGATCCTGC
CATGCCTCCTCCGCCCCCAAATCGAATAGGGCTACGAAACGACCAGTGGAAACATATGCACTGCGACGACATTCT
GTCCATGCCCGACTCCTGGGAGTATCCCTTCTTCGCCGCTTGGGACAGCGCCTTTCACTGCATTCCCCTGGCCAT
GATCGATCCCGACTTTGCCAAGAAGCAGCTGGACCTTTTTACTCGGGAGTGGTACTGCCATCCCAACGGACAGCT
TCCTGCGTTGGTCGTTTGGTCTCGCCTTGATGAGCTTCCGCTGATGATGTGACACAGATACGAGTGGAACTTTAG
CGACGTGAACCCTCCAGTTCACGCCTGGGCAACGTTCAGGGTGTTTAAGATTGAGCGCAAGATGTACGGCCGACA
GGACCTGGACTTTCTTGAACGCGTCTTTCACAAACTGCTTCTCAACTTCACCTGGTGGGTGAATCGAAAGGACGC
AAACAGCAAGAACATCTTCGAGGGCGGCTTCTTGGGGCTGGACAACATTGGCCTGTTCAACCGATCCGAGCCCTT
GCCGACGGGAGGCGTGCTGGAGCAGGCAGATAGTACGGGATGGATGGGTTTCTTTTGTCTGTCGATGCTCAACAT
TTCTCTGGAGCTGGCCAAGCATCGCCGTATCTACGAGGACATTGCGTCCAAGTTCTTTGAGCACTTTATCCTCAT
CAGCGACGCCATGACCTTCAGGGCCGGCCAGAAGAGCGAGCAGTCGCTGTGGAACGAAGAAGACGGCTTCTACTA
CGACGCCATCTCGTGGGGAGGGCCTTGGGTGCAGCAGCTGCCCGTGAGGTCGCTGGTGGGCTTGATTCCGCTGTA
CGCCACGGCCACGCTGGAGCCGGAGCTGATCAACAAGCTCCCTTCGTTCCGGAAGAGGGTCGAGTGGTTCGTCGC
CAACCGATGCGACCTGGCAGAGAGAAACATGGCCAGCATCCGGAAGAGAGGCAAGGGAGACCGCATCCTCCTTTC
CATTGTCAGCAAGGACAGGCTGGAGAAGATTCTCAAGCGGATGCTGGACGAGGACGAGTTTCTCAGCGGTCACGG
CATCCGATCGCTGTCCAAGTACCACCGGGACCACCCATACTCGATGGAAGTCAACGGGCAAAAGTTTACGGTTGG
ATACGTGCCCGGTGACTCAGACAGCGGGCTCTTTGGCGGCAACAGCAACTGGAGGGGTCCCATATGGCTGTGTGT
CAACTTTCTTCTGGTCGAGTCGCTGCAGCGTTTCTACCTGTTTTACGGGCCGGACTTCAGGGTCGAGTGCCCGAC
GGGCAGCGGGGAGTACATGCATTTGGGCCGAGTTTCGGAGGAGATTCAGCACCGGCTTCAGCACCTTTTTATCCG
GACCGAAGAGGGCAGGCGGAGCGTCAACGGCGGCGACAATCGGCTGGACTTTGACGAGCACTGGAGGAACTACAT
GTGGTTCCACGAGTTCTTTGACGGCAACTCGGGACGGGGCCTCGGGGCCAGCCATCAATGCGGCTGGACGGGTCT
GATTGCGCGTGTGATACACGATACGGGGTGAGTCTGGAGGGGGAAAGATGATGACGGAGGGCAGAGTGTTGCTGA
CTGACGACTACGGCTTTATAGGGTCAACTGCCGGCTTCCACAGACGCCACGGACGCCGTCCATCGGCATGGCGCA
TTACTTCGACGACGTGTTCCACCGAGCCGTCGACCCGGGGACCCCGACGGCGCGGCGGCACAGGCGATCGTCGAC
GGCGCGGTCCATCGGGGCACGCAGCGACTTTGACGCCAACGGGCTGGACGAGAGCGTCTTGAGCCTCGGATCGGA
TCACGCCGAGGGACGGCAAAGAGAGAGGGCCGAGGCGGACTCGCACCTCCACCGATACGTGGCGGACCAGCTCAG
CGACTACATGAAGCGGGAGGGAGAGTACCAGCACGAAGACGAGTTTGAGACGCAGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail