Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06628
Gene name
Locationscaffold_08:641366..643072
Strand-
Gene length (bp)1706
Transcript length (bp)1545
Coding sequence length (bp)1545
Protein length (aa) 515

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 4.7E-12 356 398
PF17123 zf-RING_11 RING-like zinc finger 1.3E-10 356 383
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.2E-06 356 397
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.9E-06 356 397

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 208 230 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06628
MAVLRRARCCFVAVVALLAGMASAAATISAEKDVPEWASSNALQLTLSSKPGLQFTTIPLTENLGLNESDHVRGV
VRIYGALRPANVSNYNQIKSQEDIAYLSCDKPSGDNLISPDKMLNDLMAQRPRAILLYSTSRNWCAVNSPEPLAY
TSILTMADAGEAGNVQSYLNSEAAVVNAIIQGNATEEQTVNNDSGGGGGGNNSAVAMSILYSITGLITLLFLIII
ATGAIRAHRYPERYGPRGAFGGRPRQSRAKGLARAVLDTIPIVKFGNQQPSKPDPQLELETAATVGPANGRTLSR
LPEIRPAVTDAPPPRPSPSPRRFSHDSLVSALTVSDVEEAEGVAEGVDDDDGQLGCSICTEDFRVGEDVRVLPCN
HQFHPNCVDPWLVNVSGTCPLCRLDLRPGHDSADGGSPVDEGEFLAPPLVLEAEDGGSGSGSGSGSGSQPHGNRL
SRFLDVNRLRQAPMEERMATLRQMRTRDGEWTTGGRAQGQSLTDKLKDKFLIRTRSQAEHGRRP*
Coding >Ophcf2|06628
ATGGCCGTCTTGCGTCGTGCTCGCTGCTGCTTCGTGGCCGTTGTCGCCTTGCTTGCTGGCATGGCATCTGCTGCG
GCTACCATCTCGGCCGAGAAGGATGTGCCTGAATGGGCGTCGAGTAATGCGCTTCAGCTTACGCTCTCGTCCAAG
CCCGGTCTGCAGTTTACCACGATTCCGCTGACGGAGAACCTCGGTCTTAACGAGTCGGATCACGTTCGCGGAGTT
GTCCGCATCTACGGAGCTCTGAGGCCGGCCAACGTCTCCAACTATAACCAAATCAAAAGCCAGGAGGACATCGCT
TATCTCTCGTGCGACAAGCCCAGCGGCGACAACCTCATCAGCCCAGACAAGATGCTCAACGACCTCATGGCTCAG
CGTCCCAGGGCCATCCTCCTCTACTCAACCAGCCGCAACTGGTGTGCCGTCAACAGCCCCGAACCTCTCGCCTAC
ACCAGCATCCTGACCATGGCCGACGCCGGCGAGGCTGGCAACGTCCAGAGCTACCTCAACTCCGAGGCCGCCGTC
GTCAACGCCATCATCCAGGGCAACGCCACCGAGGAGCAGACGGTCAACAACGACTCGGGCGGCGGCGGCGGCGGC
AATAACTCGGCCGTAGCCATGAGCATCCTCTACAGCATCACGGGCCTCATCACCCTCCTCTTCCTCATCATCATC
GCCACCGGAGCCATCCGCGCCCACCGTTACCCTGAGAGGTACGGCCCACGGGGCGCCTTTGGGGGCAGACCTCGC
CAGAGCCGCGCCAAGGGCCTTGCCCGAGCCGTTCTCGACACCATCCCCATCGTCAAGTTTGGCAACCAGCAGCCG
TCCAAGCCGGATCCCCAGCTCGAGCTCGAGACGGCGGCCACGGTCGGTCCCGCCAACGGCCGCACCCTCTCACGC
CTGCCCGAGATCCGGCCGGCCGTGACGGACGCGCCGCCGCCGAGACCGAGTCCGAGCCCCAGGCGCTTCAGTCAC
GACAGCCTCGTCTCGGCTCTGACCGTGTCCGACGTGGAGGAGGCTGAGGGCGTGGCTGAGGGCGTCGACGACGAC
GACGGCCAGCTCGGCTGCTCCATCTGCACCGAAGATTTCCGCGTCGGCGAGGACGTGCGGGTGCTGCCGTGCAAC
CACCAGTTCCATCCCAACTGCGTCGATCCGTGGCTCGTCAATGTTTCCGGCACATGCCCACTCTGTCGACTGGAC
CTGAGGCCGGGTCACGACAGTGCCGACGGCGGCTCCCCGGTGGATGAAGGCGAATTCCTGGCGCCGCCGCTCGTG
CTCGAGGCGGAAGACGGCGGGTCCGGGTCCGGGTCCGGGTCCGGTTCCGGGTCTCAGCCTCACGGCAACCGGCTC
TCGCGATTCCTAGACGTCAACAGGCTGCGACAGGCGCCCATGGAGGAGCGAATGGCGACGCTGCGGCAGATGCGG
ACGCGCGACGGCGAGTGGACGACGGGCGGACGAGCGCAGGGGCAGAGCCTGACGGACAAGCTCAAGGACAAGTTC
CTTATCCGCACCAGGTCTCAGGCGGAACATGGCAGGCGCCCGTAG
Transcript >Ophcf2|06628
ATGGCCGTCTTGCGTCGTGCTCGCTGCTGCTTCGTGGCCGTTGTCGCCTTGCTTGCTGGCATGGCATCTGCTGCG
GCTACCATCTCGGCCGAGAAGGATGTGCCTGAATGGGCGTCGAGTAATGCGCTTCAGCTTACGCTCTCGTCCAAG
CCCGGTCTGCAGTTTACCACGATTCCGCTGACGGAGAACCTCGGTCTTAACGAGTCGGATCACGTTCGCGGAGTT
GTCCGCATCTACGGAGCTCTGAGGCCGGCCAACGTCTCCAACTATAACCAAATCAAAAGCCAGGAGGACATCGCT
TATCTCTCGTGCGACAAGCCCAGCGGCGACAACCTCATCAGCCCAGACAAGATGCTCAACGACCTCATGGCTCAG
CGTCCCAGGGCCATCCTCCTCTACTCAACCAGCCGCAACTGGTGTGCCGTCAACAGCCCCGAACCTCTCGCCTAC
ACCAGCATCCTGACCATGGCCGACGCCGGCGAGGCTGGCAACGTCCAGAGCTACCTCAACTCCGAGGCCGCCGTC
GTCAACGCCATCATCCAGGGCAACGCCACCGAGGAGCAGACGGTCAACAACGACTCGGGCGGCGGCGGCGGCGGC
AATAACTCGGCCGTAGCCATGAGCATCCTCTACAGCATCACGGGCCTCATCACCCTCCTCTTCCTCATCATCATC
GCCACCGGAGCCATCCGCGCCCACCGTTACCCTGAGAGGTACGGCCCACGGGGCGCCTTTGGGGGCAGACCTCGC
CAGAGCCGCGCCAAGGGCCTTGCCCGAGCCGTTCTCGACACCATCCCCATCGTCAAGTTTGGCAACCAGCAGCCG
TCCAAGCCGGATCCCCAGCTCGAGCTCGAGACGGCGGCCACGGTCGGTCCCGCCAACGGCCGCACCCTCTCACGC
CTGCCCGAGATCCGGCCGGCCGTGACGGACGCGCCGCCGCCGAGACCGAGTCCGAGCCCCAGGCGCTTCAGTCAC
GACAGCCTCGTCTCGGCTCTGACCGTGTCCGACGTGGAGGAGGCTGAGGGCGTGGCTGAGGGCGTCGACGACGAC
GACGGCCAGCTCGGCTGCTCCATCTGCACCGAAGATTTCCGCGTCGGCGAGGACGTGCGGGTGCTGCCGTGCAAC
CACCAGTTCCATCCCAACTGCGTCGATCCGTGGCTCGTCAATGTTTCCGGCACATGCCCACTCTGTCGACTGGAC
CTGAGGCCGGGTCACGACAGTGCCGACGGCGGCTCCCCGGTGGATGAAGGCGAATTCCTGGCGCCGCCGCTCGTG
CTCGAGGCGGAAGACGGCGGGTCCGGGTCCGGGTCCGGGTCCGGTTCCGGGTCTCAGCCTCACGGCAACCGGCTC
TCGCGATTCCTAGACGTCAACAGGCTGCGACAGGCGCCCATGGAGGAGCGAATGGCGACGCTGCGGCAGATGCGG
ACGCGCGACGGCGAGTGGACGACGGGCGGACGAGCGCAGGGGCAGAGCCTGACGGACAAGCTCAAGGACAAGTTC
CTTATCCGCACCAGGTCTCAGGCGGAACATGGCAGGCGCCCGTAG
Gene >Ophcf2|06628
ATGGCCGTCTTGCGTCGTGCTCGCTGCTGCTTCGTGGCCGTTGTCGCCTTGCTTGCTGGCATGGCATCTGCTGCG
GCTACCATCTCGGCCGAGAAGGATGTGCCTGAATGGGCGTCGAGTAATGCGCTTCAGCTTACGCTCTCGTCCAAG
CCCGGTCTGCAGTTTACCACGATTCCGCTGACGGAGAACCTCGGTCTTAACGAGTCGGATCACGTTCGCGGAGTG
AGTCTCTTCTTTTCCCCTCCTCTTGATGCTCAGAAGAACAACGAGACGCTGACTCGGGGGGGAAAAAAAAAAGGT
TGTCCGCATCTACGGAGCTCTGAGGCCGGCCAACGTCTCCAACTATAACCAAATCAAAAGCCAGGAGGACATCGC
TTATCTCTCGTGCGACAAGCCCAGCGGCGACAACCTCATCAGCCCAGACAAGATGCTCAACGACCTCATGGCTCA
GCGTCCCAGGGCCATCCTCCTCTACTCAACCAGCCGCAACTGGTGTGCCGTCAACAGCCCCGAACCTCTCGCCTA
CACCAGCATCCTGACCATGGCCGACGCCGGCGAGGCTGGCAACGTCCAGAGCTACCTCAACTCCGAGGCCGCCGT
CGTCAACGCCATCATCCAGGGCAACGCCACCGAGGAGCAGACGGTCAACAACGACTCGGGCGGCGGCGGCGGCGG
CAATAACTCGGCCGTAGCCATGAGCATCCTCTACAGCATCACGGGCCTCATCACCCTCCTCTTCCTCATCATCAT
CGCCACCGGAGCCATCCGCGCCCACCGTTACCCTGAGAGGTACGGCCCACGGGGCGCCTTTGGGGGCAGACCTCG
CCAGAGCCGCGCCAAGGGCCTTGCCCGAGCCGTTCTCGACACCATCCCCATCGTCAAGTTTGGCAACCAGCAGCC
GTCCAAGCCGGATCCCCAGCTCGAGCTCGAGACGGCGGCCACGGTCGGTCCCGCCAACGGCCGCACCCTCTCACG
CCTGCCCGAGATCCGGCCGGCCGTGACGGACGCGCCGCCGCCGAGACCGAGTCCGAGCCCCAGGCGCTTCAGTCA
CGACAGCCTCGTCTCGGCTCTGACCGTGTCCGACGTGGAGGAGGCTGAGGGCGTGGCTGAGGGCGTCGACGACGA
CGACGGCCAGCTCGGCTGCTCCATCTGCACCGAAGATTTCCGCGTCGGCGAGGACGTGCGGGTGCTGCCGTGCAA
CCACCAGTTCCATCCCAACTGCGTCGATCCGTGGCTCGTCAATGTTTCCGGCACATGCCCACTCTGGTATGTCTC
TTGCCTCTCCCTTTTTTTCCTCGCCTGACCCCTCGAGTCTGTCTCATGTATGCGTACTAACATGGTGCCGTCTCA
GTCGACTGGACCTGAGGCCGGGTCACGACAGTGCCGACGGCGGCTCCCCGGTGGATGAAGGCGAATTCCTGGCGC
CGCCGCTCGTGCTCGAGGCGGAAGACGGCGGGTCCGGGTCCGGGTCCGGGTCCGGTTCCGGGTCTCAGCCTCACG
GCAACCGGCTCTCGCGATTCCTAGACGTCAACAGGCTGCGACAGGCGCCCATGGAGGAGCGAATGGCGACGCTGC
GGCAGATGCGGACGCGCGACGGCGAGTGGACGACGGGCGGACGAGCGCAGGGGCAGAGCCTGACGGACAAGCTCA
AGGACAAGTTCCTTATCCGCACCAGGTCTCAGGCGGAACATGGCAGGCGCCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail