Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06621
Gene name
Locationscaffold_08:616746..618889
Strand-
Gene length (bp)2143
Transcript length (bp)1812
Coding sequence length (bp)1812
Protein length (aa) 604

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.662 0.7175 0.0586 0.0742 0.0474 0.0111 0.049 0.0542 0.1532 0.0431

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup330
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|473
Ophiocordyceps australis 1348a (Ghana) OphauG2|5753
Ophiocordyceps australis map64 (Brazil) OphauB2|1217
Ophiocordyceps australis map64 (Brazil) OphauB2|3178
Ophiocordyceps camponoti-floridani Ophcf2|06621 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7420
Ophiocordyceps subramaniannii Hirsu2|3507
Ophiocordyceps subramaniannii Hirsu2|9814
Ophiocordyceps subramaniannii Hirsu2|9968
Ophiocordyceps subramaniannii Hirsu2|9969

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06621
MHWRKAHNDAEFVNLLRNLPQDDAQAVLRSVRSGTDVASIVNHFKVGDILLEMSVSPEARFRYVFPYRSELPQDV
MLDNPYLDSMIYESAALYSAGQCPSHVENQDADKERDSSCSERMKPYLHPFHATQVIDPWLSDVRPSSWTAVCHD
DNLMRDLLAGFLRCEYQFSAAFQKDYFLEDMSRQQSEFCSSLLVNIVLAYCCICYSQLERRDEYWNPTTLTYRFF
VEAQRLWQLSADVPRITTIQASILFNVFYNLCGLDEVGQSYRIHAVDLAHKICLFDDSPTIIGERTRRGRAYTAW
ALFNWESLVAFAFMHFPLLTKPPDWDLPDPLKEAQWYGEIWLKYPLSQNLSSTYFGHIFQARCRLRVIMNEFCQA
AYSKDSALTLEKAGELHSQLQSWFIGLPKPLQPRTIVLPSHLQLHMYYHHLTLAMYELLLDSGAGQDSLPLQMVT
AARKYLQTLVRLYYLRHGYDAMNLYLVIPLMLVGEHCINSIDKQTPEPRLEALRSTLILVAKGLADQRRNHYLAN
ALFRVVRGRMRPREAALLRDAVEEDAVEPPMAQAVRSHWPVSVVKNLGDMDSYILTNLVESYAQLTVELVDAAGE
GDD*
Coding >Ophcf2|06621
ATGCACTGGCGAAAGGCCCATAATGATGCCGAGTTCGTGAATCTGCTCAGGAACCTGCCTCAGGATGACGCCCAG
GCGGTCTTGCGCAGCGTCAGGTCCGGAACCGACGTCGCCTCAATTGTCAACCACTTTAAGGTTGGCGACATTCTC
CTTGAGATGTCTGTCTCTCCCGAGGCTCGATTTCGATACGTGTTTCCGTACCGATCCGAACTGCCTCAAGATGTC
ATGCTTGATAACCCTTACCTGGACTCGATGATCTACGAGTCGGCAGCATTGTACTCTGCCGGCCAATGCCCGAGC
CACGTGGAGAACCAAGACGCCGACAAGGAACGCGATTCCAGCTGCAGCGAGCGTATGAAGCCCTACCTACATCCT
TTCCATGCCACACAGGTCATTGACCCCTGGCTCTCTGATGTGAGGCCGTCGTCATGGACCGCTGTCTGCCACGAC
GACAATCTCATGCGAGATCTCCTGGCCGGGTTCTTGCGCTGCGAATACCAGTTCTCCGCGGCGTTCCAGAAAGAC
TACTTCTTGGAGGATATGTCTCGTCAACAATCCGAGTTCTGCTCGTCGCTGCTCGTCAACATTGTTCTCGCCTAC
TGTTGTATCTGCTACTCGCAACTAGAGCGCCGAGATGAATATTGGAATCCAACAACGCTCACCTACCGTTTTTTT
GTAGAAGCACAACGCCTCTGGCAGTTGTCTGCTGATGTGCCGCGCATCACCACTATCCAGGCCAGTATCTTGTTC
AATGTTTTCTACAATCTCTGTGGCCTAGACGAAGTTGGGCAGAGCTACAGAATTCACGCCGTCGATCTGGCTCAC
AAGATCTGTCTCTTTGACGACTCTCCGACTATAATCGGGGAGCGAACCCGCAGAGGCAGAGCTTACACTGCCTGG
GCTTTGTTCAACTGGGAATCGCTCGTCGCCTTCGCCTTCATGCACTTTCCGCTGCTGACGAAGCCTCCGGACTGG
GATCTCCCAGATCCTCTCAAAGAGGCACAATGGTACGGGGAGATCTGGCTCAAGTATCCGCTAAGCCAGAACCTG
TCGTCGACGTACTTTGGTCACATTTTCCAAGCGAGATGCCGGTTGCGAGTCATCATGAATGAATTTTGTCAAGCG
GCTTACTCCAAAGACTCGGCTTTGACACTAGAAAAGGCCGGCGAGCTCCATTCGCAGCTGCAAAGCTGGTTCATA
GGCTTGCCCAAGCCGCTTCAGCCGAGGACAATCGTACTCCCCAGCCACCTGCAACTACACATGTACTATCACCAT
CTCACACTCGCCATGTACGAACTACTACTCGACTCCGGAGCGGGCCAAGACTCGTTGCCGCTGCAGATGGTCACA
GCAGCCCGAAAGTATTTGCAGACGCTTGTCCGACTCTACTACCTCCGCCACGGATACGACGCCATGAACCTCTAC
CTCGTCATACCGCTCATGTTGGTCGGAGAACACTGCATCAACTCCATCGACAAGCAAACACCAGAGCCGAGACTG
GAAGCCTTGCGGTCGACGCTCATCCTCGTTGCCAAGGGGCTGGCCGACCAGCGTCGAAACCACTATCTGGCCAAC
GCGCTGTTTCGCGTCGTCCGAGGTCGCATGCGGCCGCGAGAGGCTGCTCTGCTACGAGACGCGGTCGAGGAAGAT
GCCGTGGAGCCGCCCATGGCTCAGGCGGTTCGTAGCCACTGGCCAGTCAGCGTTGTGAAGAACTTGGGGGATATG
GATTCCTATATTCTGACCAACTTGGTAGAGAGCTATGCGCAGCTCACCGTTGAGCTGGTCGACGCTGCAGGCGAA
GGTGACGACTGA
Transcript >Ophcf2|06621
ATGCACTGGCGAAAGGCCCATAATGATGCCGAGTTCGTGAATCTGCTCAGGAACCTGCCTCAGGATGACGCCCAG
GCGGTCTTGCGCAGCGTCAGGTCCGGAACCGACGTCGCCTCAATTGTCAACCACTTTAAGGTTGGCGACATTCTC
CTTGAGATGTCTGTCTCTCCCGAGGCTCGATTTCGATACGTGTTTCCGTACCGATCCGAACTGCCTCAAGATGTC
ATGCTTGATAACCCTTACCTGGACTCGATGATCTACGAGTCGGCAGCATTGTACTCTGCCGGCCAATGCCCGAGC
CACGTGGAGAACCAAGACGCCGACAAGGAACGCGATTCCAGCTGCAGCGAGCGTATGAAGCCCTACCTACATCCT
TTCCATGCCACACAGGTCATTGACCCCTGGCTCTCTGATGTGAGGCCGTCGTCATGGACCGCTGTCTGCCACGAC
GACAATCTCATGCGAGATCTCCTGGCCGGGTTCTTGCGCTGCGAATACCAGTTCTCCGCGGCGTTCCAGAAAGAC
TACTTCTTGGAGGATATGTCTCGTCAACAATCCGAGTTCTGCTCGTCGCTGCTCGTCAACATTGTTCTCGCCTAC
TGTTGTATCTGCTACTCGCAACTAGAGCGCCGAGATGAATATTGGAATCCAACAACGCTCACCTACCGTTTTTTT
GTAGAAGCACAACGCCTCTGGCAGTTGTCTGCTGATGTGCCGCGCATCACCACTATCCAGGCCAGTATCTTGTTC
AATGTTTTCTACAATCTCTGTGGCCTAGACGAAGTTGGGCAGAGCTACAGAATTCACGCCGTCGATCTGGCTCAC
AAGATCTGTCTCTTTGACGACTCTCCGACTATAATCGGGGAGCGAACCCGCAGAGGCAGAGCTTACACTGCCTGG
GCTTTGTTCAACTGGGAATCGCTCGTCGCCTTCGCCTTCATGCACTTTCCGCTGCTGACGAAGCCTCCGGACTGG
GATCTCCCAGATCCTCTCAAAGAGGCACAATGGTACGGGGAGATCTGGCTCAAGTATCCGCTAAGCCAGAACCTG
TCGTCGACGTACTTTGGTCACATTTTCCAAGCGAGATGCCGGTTGCGAGTCATCATGAATGAATTTTGTCAAGCG
GCTTACTCCAAAGACTCGGCTTTGACACTAGAAAAGGCCGGCGAGCTCCATTCGCAGCTGCAAAGCTGGTTCATA
GGCTTGCCCAAGCCGCTTCAGCCGAGGACAATCGTACTCCCCAGCCACCTGCAACTACACATGTACTATCACCAT
CTCACACTCGCCATGTACGAACTACTACTCGACTCCGGAGCGGGCCAAGACTCGTTGCCGCTGCAGATGGTCACA
GCAGCCCGAAAGTATTTGCAGACGCTTGTCCGACTCTACTACCTCCGCCACGGATACGACGCCATGAACCTCTAC
CTCGTCATACCGCTCATGTTGGTCGGAGAACACTGCATCAACTCCATCGACAAGCAAACACCAGAGCCGAGACTG
GAAGCCTTGCGGTCGACGCTCATCCTCGTTGCCAAGGGGCTGGCCGACCAGCGTCGAAACCACTATCTGGCCAAC
GCGCTGTTTCGCGTCGTCCGAGGTCGCATGCGGCCGCGAGAGGCTGCTCTGCTACGAGACGCGGTCGAGGAAGAT
GCCGTGGAGCCGCCCATGGCTCAGGCGGTTCGTAGCCACTGGCCAGTCAGCGTTGTGAAGAACTTGGGGGATATG
GATTCCTATATTCTGACCAACTTGGTAGAGAGCTATGCGCAGCTCACCGTTGAGCTGGTCGACGCTGCAGGCGAA
GGTGACGACTGA
Gene >Ophcf2|06621
ATGCACTGGCGAAAGGCCCGTATGTCATCGTTGCCTGAAGCGCCAATCAACATGCCATTACACCACTCTTCCCGG
GGAGACGAAGTCACAAGCTCTCAAAAGAGACAACCAGGGGCTCCGAAATCGACTAGATAATGATGCCGAGTTCGT
GAATCTGCTCAGGAACCTGCCTCAGGATGACGCCCAGGCGGTCTTGCGCAGCGTCAGGTCCGGAACCGACGTCGC
CTCAATTGTCAACCACTTTAAGGTTGGCGACATTCTCCTTGAGATGTCTGTCTCTCCCGAGGCTCGATTTCGATA
CGTGTTTCCGTACCGATCCGAACTGCCTCAAGATGTCATGCTTGATAACCCTTACCTGGACTCGATGATCTACGA
GTCGGCAGCATTGTACTCTGCCGGCCAATGCCCGAGCCACGTGGAGAACCAAGACGCCGACAAGGAACGCGATTC
CAGCTGCAGCGAGCGTATGAAGCCCTACCTACATCCTTTCCATGCCACACAGGTCATTGACCCCTGGCTCTCTGA
TGTGAGGCCGTCGTCATGGACCGCTGTCTGCCACGACGACAATCTCATGCGAGATCTCCTGGCCGGGTTCTTGCG
CTGCGAATACCAGTTCTCCGCGGCGTTCCAGAAAGACTACTTCTTGGAGGATATGTCTCGTCAACAATCCGAGTT
CTGCTCGTCGCTGCTCGTCAACATTGTTCTCGCCTACTGTTGTGTAAGCTTTCTTCATGTTTTATTCATCGTCGA
GACTGGCTGATGCCATAACGCAGATCTGCTACTCGCAACTAGAGCGCCGAGATGAATATTGGAATCCAACAACGC
TCACCTACCGTTTTTTTGTAGAAGCACAACGCCTCTGGCAGTTGTCTGCTGATGTGCCGCGCATCACCACTATCC
AGGCCAGTATCTTGTTCAATGTTTTCTACAATCTCTGTGGCCTAGACGAAGTTGGGCAGAGCTACAGAATTCACG
CCGTCGATCTGGCTCACAAGATCTGTCTCTTTGACGACTCTCCGACTATAATCGGGGAGCGAACCCGCAGAGGCA
GAGCTTACACTGCCTGGGCTTTGTTCAACTGGGAATCGTAAGGGCCCTCAACGATCAAGAACCTCTGCCGTCCGC
TGAAACTCGATGCTTTAGGCTCGTCGCCTTCGCCTTCATGCACTTTCCGCTGCTGACGAAGCCTCCGGACTGGGA
TCTCCCAGATCCTCTCAAAGAGGCACAATGGTACGGGGAGATCTGGCTCAAGTATCCGCTAAGCCAGAACCTGTC
GTCGACGTACTTTGGTCACATTTTCCAAGCGAGATGCCGGTTGCGAGTCATCATGAATGAATTTTGTCAAGCGGC
TTACTCCAAAGACTCGGCTTTGACACTAGAAAAGGCCGGCGAGCTCCATTCGCAGCTGCAAAGCTGGTTCATAGG
CTTGCCCAAGCCGCTTCAGCCGAGGACAATCGTACTCCCCAGCCACCTGCAACTACAGTGAGCGCTCCCTACCAA
GCCCGTCGGGTACCAGAAGGCGTAAAGCGAGCCTAGATGCTGGACCTGTTTACCCTCCTATTCGTCATGGTTTCT
GAACGCCGCCTGCAGCATGTACTATCACCATCTCACACTCGCCATGTACGAACTACTACTCGACTCCGGAGCGGG
CCAAGACTCGTTGCCGCTGCAGATGGTCACAGCAGCCCGAAAGTATTTGCAGACGCTTGTCCGACTCTACTACCT
CCGCCACGGATACGACGCCATGAACCTCTACCTCGTCATACCGCTCATGTTGGTCGGAGAACACTGCATCAACTC
CATCGACAAGCAAACACCAGAGCCGAGACTGGAAGCCTTGCGGTCGACGCTCATCCTCGTTGCCAAGGGGCTGGC
CGACCAGCGTCGAAACCACTATCTGGCCAACGCGCTGTTTCGCGTCGTCCGAGGTCGCATGCGGCCGCGAGAGGC
TGCTCTGCTACGAGACGCGGTCGAGGAAGATGCCGTGGAGCCGCCCATGGCTCAGGCGGTTCGTAGCCACTGGCC
AGTCAGCGTTGTGAAGAACTTGGGGGATATGGATTCCTATATTCTGACCAACTTGGTAGAGAGCTATGCGCAGCT
CACCGTTGAGCTGGTCGACGCTGCAGGCGAAGGTGACGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail