Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06619
Gene name
Locationscaffold_08:612505..614702
Strand-
Gene length (bp)2197
Transcript length (bp)2085
Coding sequence length (bp)2085
Protein length (aa) 695

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12998 ING Inhibitor of growth proteins N-terminal histone-binding 2.2E-05 58 190

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1352 0.8055 0.2034 0.0499 0.0399 0.0124 0.037 0.0184 0.0796 0.002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1247
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3524
Ophiocordyceps australis map64 (Brazil) OphauB2|6532
Ophiocordyceps camponoti-floridani Ophcf2|06619 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7422
Ophiocordyceps kimflemingae Ophio5|8601
Ophiocordyceps subramaniannii Hirsu2|10456

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06619
MKSAKPAPAEGPALRRSQPLRQTRVNPSRSTAADAGRDASSHGGASASQPINIFPAITHFADTMSALPKELVRHF
TLLKEVDAKLFAPEEHLAKLVAAAVAEPLPEARAGLYGGHPPLWTGAAQQADTSVSSIEDVSATNGVFDASNVPR
RQLFRQTAFRIQEMLVSLEEKNHVISTANEALQRQLVRVEDVWPYLENEFSDEAKWGSSTHWAYPENRMAGKVSH
AERARRDGAAAISAAAQALADEAAARSDARKQAVQAKRNQKNQHHDSDADDHDGRPRGETGRKSHNSKGRKAMDA
HVGGAAGTAVTNGNPPQKRRKVEKTANGANGGGCVDRAMGSVMGSSAPKAKTNSPRATPIPDLPKKRKALPSASG
QAKKKNGASRVSPSIISSPVLAAVPEPKGGIGLSPIPGNAPRPASSRARKNSMQSNAESLKAKAPSSANSKPNGS
SSSAVADPPIGASALPPPILGIDRSCKEAGASAKAEPAANEAADQFEGVGGAVPVPARKEGKAEEPECKSESLPP
QPQSAGLVTTKSGRTSKPSTPALANAQEPIRPRSSRNMEGSNGNKKQQQQQQQQQQQQQQLQQQQQQQQRRGNTT
ATAPVSHNTDEEANNSSMQGDEDEGDVDGDEPTYCYCNSVSYGEMVACDAEGCEREWFHLACVGLKVAPGSKTKW
YCEDCKERLKMGGKKTSSR*
Coding >Ophcf2|06619
ATGAAGTCGGCCAAGCCCGCGCCCGCCGAGGGTCCGGCTCTTCGCCGATCACAGCCTTTGCGGCAGACGCGTGTC
AACCCGTCTCGCTCCACCGCCGCCGATGCCGGGAGGGACGCGTCCAGCCACGGCGGCGCCTCAGCCAGCCAGCCC
ATCAACATCTTCCCTGCCATCACCCACTTCGCCGACACCATGTCTGCTCTGCCCAAGGAGCTTGTACGACACTTT
ACTCTGCTCAAAGAGGTCGACGCGAAGCTCTTCGCCCCCGAAGAACATCTGGCCAAGCTCGTTGCCGCCGCCGTC
GCCGAGCCCTTGCCTGAAGCCCGAGCTGGTCTCTATGGCGGTCATCCGCCGCTCTGGACCGGCGCCGCGCAGCAG
GCTGACACGTCTGTGTCGTCCATCGAAGACGTGTCCGCCACCAACGGCGTCTTCGACGCGTCTAATGTGCCTCGC
CGGCAACTCTTTCGACAGACGGCGTTTAGGATCCAGGAGATGCTCGTGTCTCTGGAAGAAAAGAATCATGTCATA
TCCACCGCCAATGAAGCTCTTCAGCGGCAGCTTGTCCGAGTCGAGGACGTCTGGCCATACCTCGAGAACGAATTC
AGCGACGAGGCCAAGTGGGGGAGCTCTACACACTGGGCTTATCCTGAGAACCGGATGGCTGGCAAGGTTTCGCAC
GCGGAACGAGCTCGCCGCGACGGCGCCGCTGCCATCTCGGCAGCGGCTCAGGCCTTGGCGGACGAGGCGGCCGCT
CGAAGCGATGCGAGGAAGCAGGCCGTCCAGGCGAAGCGAAACCAGAAGAACCAACATCACGACTCCGACGCCGAC
GATCACGACGGCCGGCCCAGGGGCGAGACGGGCAGGAAATCACACAACAGCAAGGGCCGCAAAGCCATGGATGCT
CACGTCGGCGGCGCGGCCGGGACTGCTGTCACTAACGGCAATCCGCCTCAGAAGAGACGCAAGGTCGAAAAGACT
GCAAACGGCGCAAACGGGGGTGGCTGCGTGGATCGCGCCATGGGCAGCGTCATGGGCAGCAGCGCGCCCAAGGCC
AAAACGAACAGCCCGAGGGCGACACCCATTCCGGACCTGCCCAAGAAGCGAAAGGCACTGCCTTCAGCCAGCGGA
CAGGCTAAGAAGAAAAACGGTGCCTCTCGCGTTTCGCCCTCGATCATATCGTCGCCAGTCCTGGCCGCCGTGCCC
GAGCCGAAAGGCGGAATCGGCCTATCACCGATCCCCGGCAACGCGCCTCGTCCAGCGTCGTCGCGCGCTCGAAAA
AACTCGATGCAATCCAACGCAGAGAGTCTCAAGGCAAAGGCGCCATCATCAGCCAACAGTAAGCCCAACGGAAGT
TCGTCTTCCGCCGTTGCAGACCCGCCAATTGGGGCGAGCGCTCTCCCTCCTCCGATATTGGGTATTGACAGAAGT
TGCAAAGAAGCCGGCGCGTCTGCCAAGGCGGAACCGGCTGCCAACGAAGCAGCAGACCAGTTCGAAGGCGTCGGA
GGAGCAGTTCCTGTGCCGGCCAGGAAAGAGGGCAAGGCAGAGGAGCCGGAATGCAAGAGCGAGTCTCTACCGCCG
CAGCCTCAAAGCGCGGGACTGGTGACGACGAAGAGCGGCAGGACGAGCAAGCCGTCGACACCAGCCTTGGCCAAC
GCGCAGGAACCTATACGGCCCAGGTCGTCGAGGAACATGGAGGGCAGCAACGGGAACAAGAAGCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAGCAACAACTACAGCAACAGCAACAGCAACAGCAGAGGCGGGGCAATACAACG
GCGACGGCACCAGTCTCTCACAACACGGACGAGGAAGCAAACAATAGTAGCATGCAGGGAGACGAGGACGAGGGC
GACGTGGATGGTGACGAACCGACGTATTGCTACTGTAACAGCGTCAGCTACGGAGAGATGGTGGCGTGTGACGCC
GAGGGCTGTGAGCGCGAGTGGTTCCATCTGGCTTGCGTCGGGCTCAAGGTAGCCCCCGGATCAAAAACGAAATGG
TACTGCGAAGACTGCAAGGAGCGGCTGAAGATGGGAGGGAAGAAGACGTCTAGCCGGTAG
Transcript >Ophcf2|06619
ATGAAGTCGGCCAAGCCCGCGCCCGCCGAGGGTCCGGCTCTTCGCCGATCACAGCCTTTGCGGCAGACGCGTGTC
AACCCGTCTCGCTCCACCGCCGCCGATGCCGGGAGGGACGCGTCCAGCCACGGCGGCGCCTCAGCCAGCCAGCCC
ATCAACATCTTCCCTGCCATCACCCACTTCGCCGACACCATGTCTGCTCTGCCCAAGGAGCTTGTACGACACTTT
ACTCTGCTCAAAGAGGTCGACGCGAAGCTCTTCGCCCCCGAAGAACATCTGGCCAAGCTCGTTGCCGCCGCCGTC
GCCGAGCCCTTGCCTGAAGCCCGAGCTGGTCTCTATGGCGGTCATCCGCCGCTCTGGACCGGCGCCGCGCAGCAG
GCTGACACGTCTGTGTCGTCCATCGAAGACGTGTCCGCCACCAACGGCGTCTTCGACGCGTCTAATGTGCCTCGC
CGGCAACTCTTTCGACAGACGGCGTTTAGGATCCAGGAGATGCTCGTGTCTCTGGAAGAAAAGAATCATGTCATA
TCCACCGCCAATGAAGCTCTTCAGCGGCAGCTTGTCCGAGTCGAGGACGTCTGGCCATACCTCGAGAACGAATTC
AGCGACGAGGCCAAGTGGGGGAGCTCTACACACTGGGCTTATCCTGAGAACCGGATGGCTGGCAAGGTTTCGCAC
GCGGAACGAGCTCGCCGCGACGGCGCCGCTGCCATCTCGGCAGCGGCTCAGGCCTTGGCGGACGAGGCGGCCGCT
CGAAGCGATGCGAGGAAGCAGGCCGTCCAGGCGAAGCGAAACCAGAAGAACCAACATCACGACTCCGACGCCGAC
GATCACGACGGCCGGCCCAGGGGCGAGACGGGCAGGAAATCACACAACAGCAAGGGCCGCAAAGCCATGGATGCT
CACGTCGGCGGCGCGGCCGGGACTGCTGTCACTAACGGCAATCCGCCTCAGAAGAGACGCAAGGTCGAAAAGACT
GCAAACGGCGCAAACGGGGGTGGCTGCGTGGATCGCGCCATGGGCAGCGTCATGGGCAGCAGCGCGCCCAAGGCC
AAAACGAACAGCCCGAGGGCGACACCCATTCCGGACCTGCCCAAGAAGCGAAAGGCACTGCCTTCAGCCAGCGGA
CAGGCTAAGAAGAAAAACGGTGCCTCTCGCGTTTCGCCCTCGATCATATCGTCGCCAGTCCTGGCCGCCGTGCCC
GAGCCGAAAGGCGGAATCGGCCTATCACCGATCCCCGGCAACGCGCCTCGTCCAGCGTCGTCGCGCGCTCGAAAA
AACTCGATGCAATCCAACGCAGAGAGTCTCAAGGCAAAGGCGCCATCATCAGCCAACAGTAAGCCCAACGGAAGT
TCGTCTTCCGCCGTTGCAGACCCGCCAATTGGGGCGAGCGCTCTCCCTCCTCCGATATTGGGTATTGACAGAAGT
TGCAAAGAAGCCGGCGCGTCTGCCAAGGCGGAACCGGCTGCCAACGAAGCAGCAGACCAGTTCGAAGGCGTCGGA
GGAGCAGTTCCTGTGCCGGCCAGGAAAGAGGGCAAGGCAGAGGAGCCGGAATGCAAGAGCGAGTCTCTACCGCCG
CAGCCTCAAAGCGCGGGACTGGTGACGACGAAGAGCGGCAGGACGAGCAAGCCGTCGACACCAGCCTTGGCCAAC
GCGCAGGAACCTATACGGCCCAGGTCGTCGAGGAACATGGAGGGCAGCAACGGGAACAAGAAGCAGCAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAGCAACAACTACAGCAACAGCAACAGCAACAGCAGAGGCGGGGCAATACAACG
GCGACGGCACCAGTCTCTCACAACACGGACGAGGAAGCAAACAATAGTAGCATGCAGGGAGACGAGGACGAGGGC
GACGTGGATGGTGACGAACCGACGTATTGCTACTGTAACAGCGTCAGCTACGGAGAGATGGTGGCGTGTGACGCC
GAGGGCTGTGAGCGCGAGTGGTTCCATCTGGCTTGCGTCGGGCTCAAGGTAGCCCCCGGATCAAAAACGAAATGG
TACTGCGAAGACTGCAAGGAGCGGCTGAAGATGGGAGGGAAGAAGACGTCTAGCCGGTAG
Gene >Ophcf2|06619
ATGAAGTCGGCCAAGCCCGCGCCCGCCGAGGGTCCGGCTCTTCGCCGATCACAGCCTTTGCGGCAGACGCGTGTC
AACCCGTCTCGCTCCACCGCCGCCGATGCCGGGAGGGACGCGTCCAGCCACGGCGGCGCCTCAGCCAGCCAGCCC
ATCAACATCTTCCCTGCCATCACCCACTTCGCCGACACCATGTCTGCTCTGCCCAAGGAGCTTGTACGACACTTT
ACTCTGCTCAAAGAGGTCGACGCGAAGCTCTTCGCCCCCGAAGAACATCTGGCCAAGCTCGTTGCCGCCGCCGTC
GCCGAGCCCTTGCCTGAAGCCCGAGCTGGTCTCTATGGCGGTCATCCGCCGCTCTGGACCGGCGCCGCGCAGCAG
GCTGACACGTCTGTGTCGTCCATCGAAGACGTGTCCGCCACCAACGGCGTCTTCGACGCGTCTAATGTGCCTCGC
CGGCAACTCTTTCGACAGACGGCGTTTAGGATCCAGGAGATGCTCGTGTCTCTGGAAGAAAAGAATCATGTCATA
TCCACCGCCAATGAAGCTCTTCAGCGGCAGCTTGTCCGAGTCGAGGACGTCTGGCCATACCTCGAGAACGAATTC
AGCGACGAGGCCAAGTGGGGGAGCTCTACACACTGGGCTTATCCTGAGAACCGGATGGCTGGCAAGGTTTCGCAC
GCGGAACGAGCTCGCCGCGACGGCGCCGCTGCCATCTCGGCAGCGGCTCAGGCCTTGGCGGACGAGGCGGCCGCT
CGAAGCGATGCGAGGAAGCAGGCCGTCCAGGCGAAGCGAAACCAGAAGAACCAACATCACGACTCCGACGCCGAC
GATCACGACGGCCGGCCCAGGGGCGAGACGGGCAGGAAATCACACAACAGCAAGGGCCGCAAAGCCATGGATGCT
CACGTCGGCGGCGCGGCCGGGACTGCTGTCACTAACGGCAATCCGCCTCAGAAGAGACGCAAGGTCGAAAAGACT
GCAAACGGCGCAAACGGGGGTGGCTGCGTGGATCGCGCCATGGGCAGCGTCATGGGCAGCAGCGCGCCCAAGGCC
AAAACGAACAGCCCGAGGGCGACACCCATTCCGGACCTGCCCAAGAAGCGAAAGGCACTGCCTTCAGCCAGCGGA
CAGGCTAAGAAGAAGTCGGTGATGATTCCTCTGCATAGATACCAAACAGGAGCTGACAGAAGATGACTGGTGCAG
AAACGGTGCCTCTCGCGTTTCGCCCTCGATCATATCGTCGCCAGTCCTGGCCGCCGTGCCCGAGCCGAAAGGCGG
AATCGGCCTATCACCGATCCCCGGCAACGCGCCTCGTCCAGCGTCGTCGCGCGCTCGAAAAAACTCGATGCAATC
CAACGCAGAGAGTCTCAAGGCAAAGGCGCCATCATCAGCCAACAGTAAGCCCAACGGAAGTTCGTCTTCCGCCGT
TGCAGACCCGCCAATTGGGGCGAGCGCTCTCCCTCCTCCGATATTGGGTATTGACAGAAGTTGCAAAGAAGCCGG
CGCGTCTGCCAAGGCGGAACCGGCTGCCAACGAAGCAGCAGACCAGTTCGAAGGCGTCGGAGGAGCAGTTCCTGT
GCCGGCCAGGAAAGAGGGCAAGGCAGAGGAGCCGGAATGCAAGAGCGAGTCTCTACCGCCGCAGCCTCAAAGCGC
GGGACTGGTGACGACGAAGAGCGGCAGGACGAGCAAGCCGTCGACACCAGCCTTGGCCAACGCGCAGGAACCTAT
ACGGCCCAGGTCGTCGAGGAACATGGAGGGCAGCAACGGGAACAAGAAGCAGCAGCAGCAGCAGCAGCAGCAGCA
GCAGCAGCAGCAACAACTACAGCAACAGCAACAGCAACAGCAGAGGCGGGGCAATACAACGGCGACGGCACCAGT
CTCTCACAACACGGACGAGGAAGCAAACAATAGTAGCATGCAGGGAGACGAGGACGAGGGCGACGTGGATGGTGA
CGAACCGACGTATTGCTACTGTAACAGCGTCAGCTACGGAGAGATGGTGGCGTGTGACGCCGAGGGCTGTGAGCG
CGAGTGGTTCCATCTGGCTTGCGTCGGGCTCAAGGTAGCCCCCGGATCAAAAAGTGAGTTGTGCCGATTTCCGGG
ATGCTGACGAGGCTGACGAGGCTCGGTAGCGAAATGGTACTGCGAAGACTGCAAGGAGCGGCTGAAGATGGGAGG
GAAGAAGACGTCTAGCCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail