Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06608
Gene name
Locationscaffold_08:579851..581557
Strand-
Gene length (bp)1706
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08598 Sds3 Sds3-like 1.3E-23 32 234

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3275 0.9213 0.1499 0.0443 0.0753 0.0018 0.0175 0.0229 0.0101 0.0032

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3859
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3902
Ophiocordyceps australis map64 (Brazil) OphauB2|6517
Ophiocordyceps camponoti-floridani Ophcf2|06608 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3233
Ophiocordyceps kimflemingae Ophio5|5011
Ophiocordyceps subramaniannii Hirsu2|7647

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06608
MSASDPVLPLALAASRAESSQSKRDRKRQVVMERLAALTDKFQHDKDSAYRDQLQRIQLELNKLQKFDPYASNAI
EVAGDVQREYKQATAMAVRAENARSLMDMAGLQFPQFMSDVQDVLETRDYQLTQSKNDYERKVQQYKNTHMFKME
TAKREHHALNSTMRDRLVNHLNTKKARLVKEKEAFETSDSHALLLNPNQFHLPGPGSPGGHPGKRSTRNRKEMAD
NHDGFGESKKRKRNAGDDDGSPAPTRRALDPSVTTPYWQSEKARIEARKQGPPYSLASLFTEKELSMHYNTAALA
SHNHILRHRSVGNDTSASQGISDSGNADHEAGDGDAQLQAPSSSAPAMERQPSHATRSTRVAAQSNFSDDKLFGL
EGIGSFELPSNLDLMHGPECTPKMPAVPPYPPYTKVSSKGEQSLPNALSEKEVAVDFQIMACLKQYDVGRCPGSH
LDNPKGLRKTFEAIATPYQAGRFMSLAKVSRENEAEVLRESFGVGLPTSSVRDQSSPGRGVNGQATGGTPMSRQS
SAGGVAMSRQGTTGSGRTKTRRG*
Coding >Ophcf2|06608
ATGTCTGCGAGCGATCCCGTTCTCCCCCTGGCCCTGGCTGCTAGCCGAGCCGAGTCGTCGCAGTCAAAGAGAGAT
CGCAAGCGTCAGGTCGTCATGGAGCGCCTCGCCGCCCTGACGGATAAGTTCCAGCACGACAAGGACTCGGCCTAC
CGCGATCAGCTCCAGCGGATCCAGTTGGAGCTCAACAAGCTACAGAAATTCGACCCTTACGCCTCCAACGCCATC
GAGGTCGCTGGCGATGTCCAGCGTGAATACAAGCAGGCCACGGCGATGGCCGTGCGCGCCGAAAACGCCAGGAGC
CTGATGGATATGGCTGGCCTGCAGTTTCCTCAGTTCATGTCTGACGTTCAGGACGTTCTCGAGACTCGCGATTAC
CAGCTTACGCAGTCCAAGAATGACTACGAACGCAAGGTGCAACAGTACAAGAACACGCACATGTTCAAGATGGAG
ACGGCTAAGCGGGAGCACCATGCGCTCAACTCGACCATGCGCGACCGGCTGGTCAATCACCTCAATACCAAGAAG
GCTCGGCTGGTGAAGGAGAAGGAGGCCTTTGAGACGAGCGACTCCCACGCGCTGCTCCTCAATCCCAACCAGTTC
CACCTCCCGGGCCCCGGCAGCCCTGGCGGCCATCCCGGGAAGCGATCGACGCGGAACCGCAAGGAGATGGCCGAC
AACCACGACGGCTTCGGAGAGAGTAAAAAGCGGAAGCGCAATGCTGGTGACGACGATGGTTCACCTGCGCCGACG
CGACGCGCGCTGGACCCGAGCGTCACGACGCCTTACTGGCAGTCGGAGAAGGCCCGGATTGAGGCCAGGAAGCAG
GGGCCTCCTTACAGCCTCGCGAGTCTCTTTACGGAAAAGGAGCTTTCGATGCACTACAACACGGCGGCGCTCGCT
TCCCACAACCACATCCTTCGTCACCGCTCCGTCGGCAATGACACGTCTGCTTCGCAAGGTATCAGCGACTCGGGC
AACGCCGACCACGAGGCAGGCGACGGCGATGCTCAGCTACAAGCGCCGTCTTCGTCTGCGCCCGCCATGGAGCGT
CAGCCGTCGCACGCCACCAGGAGCACGCGAGTGGCGGCGCAGAGCAATTTCTCAGACGACAAGCTGTTTGGGCTC
GAGGGCATCGGGAGCTTCGAGCTTCCGTCGAACCTGGACCTGATGCACGGGCCCGAATGCACGCCCAAGATGCCG
GCAGTGCCGCCCTATCCACCATATACCAAGGTCAGCTCCAAGGGAGAGCAATCGCTTCCAAACGCGCTGTCGGAG
AAGGAAGTGGCCGTGGATTTTCAAATCATGGCCTGCCTGAAGCAATACGACGTAGGGCGCTGCCCGGGAAGCCAC
CTGGATAACCCCAAGGGCTTGCGGAAGACGTTCGAGGCCATTGCGACGCCGTACCAAGCGGGCAGGTTCATGTCG
CTGGCCAAGGTGAGCCGCGAGAACGAGGCCGAAGTGTTGCGGGAGTCGTTCGGCGTCGGATTGCCCACCAGCAGC
GTGCGCGATCAGTCGAGTCCGGGACGAGGCGTCAACGGACAGGCGACGGGAGGCACGCCGATGAGCCGACAGAGC
AGCGCTGGCGGCGTGGCCATGAGCCGACAGGGAACGACGGGTAGCGGACGGACCAAGACGAGGAGAGGATAA
Transcript >Ophcf2|06608
ATGTCTGCGAGCGATCCCGTTCTCCCCCTGGCCCTGGCTGCTAGCCGAGCCGAGTCGTCGCAGTCAAAGAGAGAT
CGCAAGCGTCAGGTCGTCATGGAGCGCCTCGCCGCCCTGACGGATAAGTTCCAGCACGACAAGGACTCGGCCTAC
CGCGATCAGCTCCAGCGGATCCAGTTGGAGCTCAACAAGCTACAGAAATTCGACCCTTACGCCTCCAACGCCATC
GAGGTCGCTGGCGATGTCCAGCGTGAATACAAGCAGGCCACGGCGATGGCCGTGCGCGCCGAAAACGCCAGGAGC
CTGATGGATATGGCTGGCCTGCAGTTTCCTCAGTTCATGTCTGACGTTCAGGACGTTCTCGAGACTCGCGATTAC
CAGCTTACGCAGTCCAAGAATGACTACGAACGCAAGGTGCAACAGTACAAGAACACGCACATGTTCAAGATGGAG
ACGGCTAAGCGGGAGCACCATGCGCTCAACTCGACCATGCGCGACCGGCTGGTCAATCACCTCAATACCAAGAAG
GCTCGGCTGGTGAAGGAGAAGGAGGCCTTTGAGACGAGCGACTCCCACGCGCTGCTCCTCAATCCCAACCAGTTC
CACCTCCCGGGCCCCGGCAGCCCTGGCGGCCATCCCGGGAAGCGATCGACGCGGAACCGCAAGGAGATGGCCGAC
AACCACGACGGCTTCGGAGAGAGTAAAAAGCGGAAGCGCAATGCTGGTGACGACGATGGTTCACCTGCGCCGACG
CGACGCGCGCTGGACCCGAGCGTCACGACGCCTTACTGGCAGTCGGAGAAGGCCCGGATTGAGGCCAGGAAGCAG
GGGCCTCCTTACAGCCTCGCGAGTCTCTTTACGGAAAAGGAGCTTTCGATGCACTACAACACGGCGGCGCTCGCT
TCCCACAACCACATCCTTCGTCACCGCTCCGTCGGCAATGACACGTCTGCTTCGCAAGGTATCAGCGACTCGGGC
AACGCCGACCACGAGGCAGGCGACGGCGATGCTCAGCTACAAGCGCCGTCTTCGTCTGCGCCCGCCATGGAGCGT
CAGCCGTCGCACGCCACCAGGAGCACGCGAGTGGCGGCGCAGAGCAATTTCTCAGACGACAAGCTGTTTGGGCTC
GAGGGCATCGGGAGCTTCGAGCTTCCGTCGAACCTGGACCTGATGCACGGGCCCGAATGCACGCCCAAGATGCCG
GCAGTGCCGCCCTATCCACCATATACCAAGGTCAGCTCCAAGGGAGAGCAATCGCTTCCAAACGCGCTGTCGGAG
AAGGAAGTGGCCGTGGATTTTCAAATCATGGCCTGCCTGAAGCAATACGACGTAGGGCGCTGCCCGGGAAGCCAC
CTGGATAACCCCAAGGGCTTGCGGAAGACGTTCGAGGCCATTGCGACGCCGTACCAAGCGGGCAGGTTCATGTCG
CTGGCCAAGGTGAGCCGCGAGAACGAGGCCGAAGTGTTGCGGGAGTCGTTCGGCGTCGGATTGCCCACCAGCAGC
GTGCGCGATCAGTCGAGTCCGGGACGAGGCGTCAACGGACAGGCGACGGGAGGCACGCCGATGAGCCGACAGAGC
AGCGCTGGCGGCGTGGCCATGAGCCGACAGGGAACGACGGGTAGCGGACGGACCAAGACGAGGAGAGGATAA
Gene >Ophcf2|06608
ATGTCTGCGAGCGATCCCGTTCTCCCCCTGGCCCTGGCTGCTAGCCGAGCCGAGTCGTCGCAGTCAAAGAGAGAT
CGCAAGCGTCAGGTCGTCATGGAGCGCCTCGCCGCCCTGACGGATAAGTTCCAGCACGACAAGGACTCGGCCTAC
CGCGATCAGCTCCAGCGGATCCAGTTGGAGCTCAACAAGCTACAGAAATTCGACCCTTACGCCTCCAACGCCATC
GAGGTCGCTGGCGATGTCCAGCGTGAATACAAGCAGGCCACGGCGATGGCCGTGCGCGCCGAAAACGCCAGGAGC
CTGATGGATATGGCTGGCCTGCAGTTTCCTCAGTTCATGTCTGACGTTCAGGACGTTCTCGAGACTCGCGATTAC
CAGCTTACGCAGTCCAAGGTACGAGGGTAGAAACGCGCTGCTAATGTTGGCTGTTTGCTAATTGTTTGCCGCGAC
AGAATGACTACGAACGCAAGGTGCAACAGTACAAGAACACGCACATGTTCAAGATGGAGACGGCTAAGCGGGAGC
ACCATGCGCTCAACTCGACCATGCGCGACCGGCTGGTCAATCACCTCAATACCAAGAAGGCTCGGCTGGTGAAGG
AGAAGGAGGCCTTTGAGACGAGCGACTCCCACGCGCTGCTCCTCAATCCCAACCAGTTCCACCTCCCGGGCCCCG
GCAGCCCTGGCGGCCATCCCGGGAAGCGATCGACGCGGAACCGCAAGGAGATGGCCGACAACCACGACGGCTTCG
GAGAGAGTAAAAAGCGGAAGCGCAATGCTGGTGACGACGATGGTTCACCTGCGCCGACGCGACGCGCGCTGGACC
CGAGCGTCACGACGCCTTACTGGCAGTCGGAGAAGGCCCGGATTGAGGCCAGGAAGCAGGGGCCTCCTTACAGCC
TCGCGAGTCTCTTTACGGAAAAGGAGCTTTCGATGCACTACAACACGGCGGCGCTCGCTTCCCACAACCACATCC
TTCGTCACCGCTCCGTCGGCAATGACACGTCTGCTTCGCAAGGTATCAGCGACTCGGGCAACGCCGACCACGAGG
CAGGCGACGGCGATGCTCAGCTACAAGCGCCGTCTTCGTCTGCGCCCGCCATGGAGCGTCAGCCGTCGCACGCCA
CCAGGAGCACGCGAGTGGCGGCGCAGAGCAATTTCTCAGACGACAAGCTGTTTGGGCTCGAGGGCATCGGGAGCT
TCGAGCTTCCGTCGAACCTGGACCTGATGCACGGGCCCGAATGCACGCCCAAGATGCCGGCAGTGCCGCCCTATC
CACCATATACCAAGGTCAGCTCCAAGGGAGAGCAATCGCTTCCAAACGCGCTGTCGGAGAAGGAAGTGGCCGTGG
ATTTTCAAATCATGGCCTGCCTGAAGCAATACGACGTAGGGCGCTGCCCGGGAAGCCACCTGGATAACCCCAAGG
GCTTGCGGAAGACGTTCGAGGCCATTGCGACGCCGTACCAAGCGGGCAGGTTCATGTCGCTGGCCAAGGTGAGCC
GCGAGAACGAGGCCGAAGTGTTGCGGGAGTCGTTCGGCGTCGGATTGCCCACCAGCAGCGTGCGCGATCAGTCGA
GTCCGGGACGAGGCGTCAACGGACAGGCGACGGGAGGCACGCCGATGAGCCGACAGAGCAGCGCTGGCGGCGTGG
CCATGAGCCGACAGGGAACGACGGGTAGCGGACGGACCAAGACGAGGAGAGGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail