Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06604
Gene name
Locationscaffold_08:567208..570066
Strand-
Gene length (bp)2858
Transcript length (bp)2538
Coding sequence length (bp)2538
Protein length (aa) 846

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20428 Sey1_3HB Sey1 three-helix bundle domain 2.4E-138 351 788
PF05879 RHD3_GTPase Root hair defective 3 GTP-binding protein (RHD3) GTPase domain 1.3E-123 50 304
PF02263 GBP Guanylate-binding protein, N-terminal domain 1.2E-07 46 157
PF01926 MMR_HSR1 50S ribosome-binding GTPase 7.5E-05 47 120

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0003824 catalytic activity No
GO:0016462 pyrophosphatase activity No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 725 747 22
2 754 776 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06604
MNGHFLAEGGFEHGVQVVDEDKAFNSNVADYLSVCRVAEAGFNYHLVSVFGSQSTGKSTLLNHLFGTDFSVMSET
ERRQTTKGIWMAKNKRADMADNILVMDVEGTDGRERGEDQDFERKSALFALATSEVLIVNIWEHQVGLYQGANMG
LLKTVFEVNLQLFLKDKQSTPRSLLFFVIRDHIGTTPLSNLRTTLTQDLTKIWSTIAKPEGLEGSRIEDYFDFAF
AALPHKILQEEKFRSDARQLGSRFVPGHRVGKPGSHGDQELEGGVFLPEYHRRIPADGLSVYAEGIWDQIVHNKD
LDLPTQQELLAQFRCDEISRDVLLAFDLVVVPLEERQTKAAELGKPLVLADLGATGSKARSECVRAFEAQAGRYH
KGTFSRKKQELEGKVDTRLKALYQGQLAAAHKAGVAAFSEAVSGKVKTGQKTGGYDFADIVAQEKASAVEAFEAE
VTGLTMQGVAWTDFGPQCQLFEAELDEVSGRLRKEEMRRLATRVERWVRSRLGEDVGLEFNKLGSGRGGSGAPET
GEMAGNAERQLWDRIWTAFTGIVAEAESRFAERARSFDASGHEVEIGMWRLRRKSWVGLREKIEEEVMDGNILLK
LRENFEDKFRYDEAGVPRIWRPSDDIEGLYTKARESTLTLIPLLSRFQLSESGYPDLPAFIGPQPEMENGDEEDL
APIGGVDEGENESLEEEMMVLSEAKRQDLVVRFKKTADGVYVEAKRSAIGGVAQVPWYFYGLLMALGWNEFYMVL
RNPFLCILLLLMAGGTYVAYTLNLVGPMMQMGNAAVNQGIDIAKQQLRDFIVNSETARQALAVPSSSSDTRLDAL
DGRGKKVNGDDGGDDGDDGF*
Coding >Ophcf2|06604
ATGAATGGCCACTTTTTAGCTGAGGGTGGCTTTGAGCATGGGGTTCAGGTTGTGGATGAGGATAAGGCCTTTAAT
TCCAATGTCGCCGACTACCTAAGCGTCTGCCGCGTCGCCGAAGCCGGCTTCAACTACCATCTCGTCTCCGTCTTC
GGATCTCAGTCAACGGGAAAGTCGACGCTGCTCAACCACCTCTTCGGCACAGACTTCTCCGTCATGTCCGAGACG
GAGCGCCGTCAGACAACAAAGGGTATATGGATGGCCAAGAATAAGCGGGCGGACATGGCCGACAATATCCTCGTC
ATGGACGTTGAGGGGACCGACGGTCGCGAGCGTGGTGAGGACCAGGACTTTGAGCGGAAGAGTGCCCTCTTTGCG
CTGGCTACTAGCGAGGTCCTCATCGTCAATATCTGGGAGCATCAAGTTGGTCTCTACCAGGGTGCCAATATGGGC
CTGCTCAAGACCGTCTTTGAGGTCAACCTGCAGCTCTTTCTCAAGGACAAACAGTCCACGCCCAGATCGCTTCTC
TTCTTCGTCATCCGTGATCACATCGGCACGACGCCGCTGTCCAATCTACGCACCACCCTGACCCAGGACTTGACC
AAGATATGGTCCACCATCGCCAAGCCCGAGGGATTGGAGGGCTCTCGCATAGAAGACTACTTCGACTTTGCTTTC
GCCGCTCTGCCTCATAAGATCCTCCAGGAGGAAAAGTTCCGCTCCGACGCCCGTCAGCTCGGATCGCGCTTCGTG
CCAGGTCACAGGGTCGGAAAGCCGGGCAGCCACGGCGACCAGGAGCTCGAGGGCGGCGTCTTCCTACCCGAATAC
CATCGTCGGATCCCCGCCGACGGGCTGTCCGTCTACGCCGAGGGCATCTGGGACCAGATCGTTCACAACAAGGAC
CTCGACCTCCCAACCCAGCAGGAGCTCCTGGCTCAATTCCGGTGCGACGAGATCTCGCGCGACGTTCTGCTCGCC
TTCGATCTCGTCGTTGTGCCCCTCGAGGAGCGGCAGACCAAGGCGGCCGAGTTGGGCAAGCCTCTGGTCTTGGCC
GACCTGGGCGCCACCGGGAGCAAGGCGCGCTCCGAATGTGTCAGGGCCTTTGAGGCCCAGGCCGGCCGCTATCAT
AAGGGTACCTTTTCACGGAAGAAACAAGAGCTCGAGGGAAAGGTCGACACGCGGCTAAAGGCCCTCTATCAGGGC
CAACTCGCGGCGGCACACAAGGCGGGCGTCGCGGCCTTTAGCGAGGCCGTGTCCGGAAAGGTCAAGACGGGGCAA
AAGACCGGTGGTTACGACTTTGCCGACATCGTGGCCCAGGAGAAGGCCAGTGCCGTGGAGGCATTCGAGGCCGAG
GTGACGGGGCTGACGATGCAGGGTGTGGCCTGGACCGACTTTGGGCCTCAATGTCAGCTATTCGAGGCCGAGTTG
GATGAGGTGAGCGGGCGGTTGCGCAAGGAGGAGATGCGGCGGCTGGCGACGCGAGTCGAGCGTTGGGTCCGGTCG
CGGCTCGGCGAGGACGTCGGCCTCGAGTTCAACAAGCTCGGCTCCGGTAGAGGCGGCTCCGGCGCACCCGAGACG
GGGGAGATGGCCGGGAACGCGGAGAGACAACTGTGGGATCGGATTTGGACCGCCTTCACCGGCATCGTGGCCGAG
GCTGAGAGCCGGTTCGCCGAACGGGCACGGAGCTTCGATGCCAGCGGTCACGAGGTGGAGATAGGCATGTGGCGA
CTGCGGCGCAAGAGCTGGGTAGGGCTGAGGGAGAAGATCGAGGAAGAGGTTATGGATGGCAACATCCTGTTGAAG
CTGCGGGAGAACTTCGAGGACAAGTTCCGTTACGACGAAGCGGGCGTTCCGCGGATTTGGCGACCGAGCGATGAT
ATCGAGGGCCTATACACCAAGGCGCGCGAATCAACGCTGACTCTAATCCCGCTACTATCACGGTTCCAACTATCG
GAAAGCGGGTATCCGGATCTGCCGGCCTTTATCGGGCCGCAGCCTGAGATGGAGAACGGCGACGAGGAGGATCTA
GCGCCCATCGGGGGAGTGGATGAGGGCGAGAACGAGAGCTTGGAAGAGGAGATGATGGTTCTCAGTGAGGCCAAG
AGACAGGATCTCGTGGTTCGGTTCAAGAAGACGGCCGATGGTGTCTATGTCGAGGCTAAGAGGAGTGCTATCGGC
GGGGTGGCGCAAGTGCCGTGGTATTTCTATGGGCTGCTCATGGCACTGGGGTGGAACGAGTTTTATATGGTCCTA
CGAAACCCGTTCCTATGCATCCTACTCCTGCTAATGGCCGGCGGGACGTATGTCGCTTACACGCTCAACCTTGTA
GGCCCGATGATGCAGATGGGCAACGCGGCCGTTAACCAGGGCATCGACATCGCCAAGCAGCAACTGCGCGACTTC
ATCGTCAACTCGGAGACGGCCAGACAGGCATTGGCCGTTCCATCTTCGTCGTCGGACACGCGCTTGGACGCGCTC
GACGGGCGGGGGAAGAAAGTGAACGGTGACGATGGGGGGGATGATGGGGATGATGGGTTTTGA
Transcript >Ophcf2|06604
ATGAATGGCCACTTTTTAGCTGAGGGTGGCTTTGAGCATGGGGTTCAGGTTGTGGATGAGGATAAGGCCTTTAAT
TCCAATGTCGCCGACTACCTAAGCGTCTGCCGCGTCGCCGAAGCCGGCTTCAACTACCATCTCGTCTCCGTCTTC
GGATCTCAGTCAACGGGAAAGTCGACGCTGCTCAACCACCTCTTCGGCACAGACTTCTCCGTCATGTCCGAGACG
GAGCGCCGTCAGACAACAAAGGGTATATGGATGGCCAAGAATAAGCGGGCGGACATGGCCGACAATATCCTCGTC
ATGGACGTTGAGGGGACCGACGGTCGCGAGCGTGGTGAGGACCAGGACTTTGAGCGGAAGAGTGCCCTCTTTGCG
CTGGCTACTAGCGAGGTCCTCATCGTCAATATCTGGGAGCATCAAGTTGGTCTCTACCAGGGTGCCAATATGGGC
CTGCTCAAGACCGTCTTTGAGGTCAACCTGCAGCTCTTTCTCAAGGACAAACAGTCCACGCCCAGATCGCTTCTC
TTCTTCGTCATCCGTGATCACATCGGCACGACGCCGCTGTCCAATCTACGCACCACCCTGACCCAGGACTTGACC
AAGATATGGTCCACCATCGCCAAGCCCGAGGGATTGGAGGGCTCTCGCATAGAAGACTACTTCGACTTTGCTTTC
GCCGCTCTGCCTCATAAGATCCTCCAGGAGGAAAAGTTCCGCTCCGACGCCCGTCAGCTCGGATCGCGCTTCGTG
CCAGGTCACAGGGTCGGAAAGCCGGGCAGCCACGGCGACCAGGAGCTCGAGGGCGGCGTCTTCCTACCCGAATAC
CATCGTCGGATCCCCGCCGACGGGCTGTCCGTCTACGCCGAGGGCATCTGGGACCAGATCGTTCACAACAAGGAC
CTCGACCTCCCAACCCAGCAGGAGCTCCTGGCTCAATTCCGGTGCGACGAGATCTCGCGCGACGTTCTGCTCGCC
TTCGATCTCGTCGTTGTGCCCCTCGAGGAGCGGCAGACCAAGGCGGCCGAGTTGGGCAAGCCTCTGGTCTTGGCC
GACCTGGGCGCCACCGGGAGCAAGGCGCGCTCCGAATGTGTCAGGGCCTTTGAGGCCCAGGCCGGCCGCTATCAT
AAGGGTACCTTTTCACGGAAGAAACAAGAGCTCGAGGGAAAGGTCGACACGCGGCTAAAGGCCCTCTATCAGGGC
CAACTCGCGGCGGCACACAAGGCGGGCGTCGCGGCCTTTAGCGAGGCCGTGTCCGGAAAGGTCAAGACGGGGCAA
AAGACCGGTGGTTACGACTTTGCCGACATCGTGGCCCAGGAGAAGGCCAGTGCCGTGGAGGCATTCGAGGCCGAG
GTGACGGGGCTGACGATGCAGGGTGTGGCCTGGACCGACTTTGGGCCTCAATGTCAGCTATTCGAGGCCGAGTTG
GATGAGGTGAGCGGGCGGTTGCGCAAGGAGGAGATGCGGCGGCTGGCGACGCGAGTCGAGCGTTGGGTCCGGTCG
CGGCTCGGCGAGGACGTCGGCCTCGAGTTCAACAAGCTCGGCTCCGGTAGAGGCGGCTCCGGCGCACCCGAGACG
GGGGAGATGGCCGGGAACGCGGAGAGACAACTGTGGGATCGGATTTGGACCGCCTTCACCGGCATCGTGGCCGAG
GCTGAGAGCCGGTTCGCCGAACGGGCACGGAGCTTCGATGCCAGCGGTCACGAGGTGGAGATAGGCATGTGGCGA
CTGCGGCGCAAGAGCTGGGTAGGGCTGAGGGAGAAGATCGAGGAAGAGGTTATGGATGGCAACATCCTGTTGAAG
CTGCGGGAGAACTTCGAGGACAAGTTCCGTTACGACGAAGCGGGCGTTCCGCGGATTTGGCGACCGAGCGATGAT
ATCGAGGGCCTATACACCAAGGCGCGCGAATCAACGCTGACTCTAATCCCGCTACTATCACGGTTCCAACTATCG
GAAAGCGGGTATCCGGATCTGCCGGCCTTTATCGGGCCGCAGCCTGAGATGGAGAACGGCGACGAGGAGGATCTA
GCGCCCATCGGGGGAGTGGATGAGGGCGAGAACGAGAGCTTGGAAGAGGAGATGATGGTTCTCAGTGAGGCCAAG
AGACAGGATCTCGTGGTTCGGTTCAAGAAGACGGCCGATGGTGTCTATGTCGAGGCTAAGAGGAGTGCTATCGGC
GGGGTGGCGCAAGTGCCGTGGTATTTCTATGGGCTGCTCATGGCACTGGGGTGGAACGAGTTTTATATGGTCCTA
CGAAACCCGTTCCTATGCATCCTACTCCTGCTAATGGCCGGCGGGACGTATGTCGCTTACACGCTCAACCTTGTA
GGCCCGATGATGCAGATGGGCAACGCGGCCGTTAACCAGGGCATCGACATCGCCAAGCAGCAACTGCGCGACTTC
ATCGTCAACTCGGAGACGGCCAGACAGGCATTGGCCGTTCCATCTTCGTCGTCGGACACGCGCTTGGACGCGCTC
GACGGGCGGGGGAAGAAAGTGAACGGTGACGATGGGGGGGATGATGGGGATGATGGGTTTTGA
Gene >Ophcf2|06604
ATGAATGGCCACTTTTTAGCTGAGGGTGGCTTTGAGCATGGGGTTCAGGTTGTGGATGAGGATAAGGCCTTTAAG
TATGGAAATCTTTGCTACGAAATCTTGTTTCGCTCTGTTGTCCTTGTCTCTTCTCCTGTTTTGTTCTCCTGTCTC
GCTCCTGTGCCGGTCTCTTGGACCCGTTCATCCATCTCGTTATCCTGTCGCGTTCCCATCTTCTCTTCTCTTTGG
ATCCGCTCCCATATCCGACGCGTTCTGCTTCTTCGGCAGACTGACATTCCCTTGGCAGTTCCAATGTCGCCGACT
ACCTAAGCGTCTGCCGCGTCGCCGAAGCCGGCTTCAACTACCATCTCGTCTCCGTCTTCGGATCTCAGTCAACGG
GAAAGTCGACGCTGCTCAACCACCTCTTCGGCACAGACTTCTCCGTCATGTCCGAGACGGAGCGCCGTCAGACAA
CAAAGGGTATATGGATGGCCAAGAATAAGCGGGCGGACATGGCCGACAATATCCTCGTCATGGACGTTGAGGGGA
CCGACGGTCGCGAGCGTGGTGAGGACCAGGACTTTGAGCGGAAGAGTGCCCTCTTTGCGCTGGCTACTAGCGAGG
TCCTCATCGTCAATATCTGGGAGCATCAAGTTGGTCTCTACCAGGGTGCCAATATGGGCCTGCTCAAGACCGTCT
TTGAGGTCAACCTGCAGCTCTTTCTCAAGGACAAACAGTACGTGGGGGCTTCGGCCGTTTCCTTTCCTGGACACT
GACGCCGCCCAGGTCCACGCCCAGATCGCTTCTCTTCTTCGTCATCCGTGATCACATCGGCACGACGCCGCTGTC
CAATCTACGCACCACCCTGACCCAGGACTTGACCAAGATATGGTCCACCATCGCCAAGCCCGAGGGATTGGAGGG
CTCTCGCATAGAAGACTACTTCGACTTTGCTTTCGCCGCTCTGCCTCATAAGATCCTCCAGGAGGAAAAGTTCCG
CTCCGACGCCCGTCAGCTCGGATCGCGCTTCGTGCCAGGTCACAGGGTCGGAAAGCCGGGCAGCCACGGCGACCA
GGAGCTCGAGGGCGGCGTCTTCCTACCCGAATACCATCGTCGGATCCCCGCCGACGGGCTGTCCGTCTACGCCGA
GGGCATCTGGGACCAGATCGTTCACAACAAGGACCTCGACCTCCCAACCCAGCAGGAGCTCCTGGCTCAATTCCG
GTGCGACGAGATCTCGCGCGACGTTCTGCTCGCCTTCGATCTCGTCGTTGTGCCCCTCGAGGAGCGGCAGACCAA
GGCGGCCGAGTTGGGCAAGCCTCTGGTCTTGGCCGACCTGGGCGCCACCGGGAGCAAGGCGCGCTCCGAATGTGT
CAGGGCCTTTGAGGCCCAGGCCGGCCGCTATCATAAGGGTACCTTTTCACGGAAGAAACAAGAGCTCGAGGGAAA
GGTCGACACGCGGCTAAAGGCCCTCTATCAGGGCCAACTCGCGGCGGCACACAAGGCGGGCGTCGCGGCCTTTAG
CGAGGCCGTGTCCGGAAAGGTCAAGACGGGGCAAAAGACCGGTGGTTACGACTTTGCCGACATCGTGGCCCAGGA
GAAGGCCAGTGCCGTGGAGGCATTCGAGGCCGAGGTGACGGGGCTGACGATGCAGGGTGTGGCCTGGACCGACTT
TGGGCCTCAATGTCAGCTATTCGAGGCCGAGTTGGATGAGGTGAGCGGGCGGTTGCGCAAGGAGGAGATGCGGCG
GCTGGCGACGCGAGTCGAGCGTTGGGTCCGGTCGCGGCTCGGCGAGGACGTCGGCCTCGAGTTCAACAAGCTCGG
CTCCGGTAGAGGCGGCTCCGGCGCACCCGAGACGGGGGAGATGGCCGGGAACGCGGAGAGACAACTGTGGGATCG
GATTTGGACCGCCTTCACCGGCATCGTGGCCGAGGCTGAGAGCCGGTTCGCCGAACGGGCACGGAGCTTCGATGC
CAGCGGTCACGAGGTGGAGATAGGCATGTGGCGACTGCGGCGCAAGAGCTGGGTAGGGCTGAGGGAGAAGATCGA
GGAAGAGGTTATGGATGGCAACATCCTGTTGAAGCTGCGGGAGAACTTCGAGGACAAGTTCCGTTACGACGAAGC
GGGCGTTCCGCGGATTTGGCGACCGAGCGATGATATCGAGGGCCTATACACCAAGGCGCGCGAATCAACGCTGAC
TCTAATCCCGCTACTATCACGGTTCCAACTATCGGAAAGCGGGTATCCGGATCTGCCGGCCTTTATCGGGCCGCA
GCCTGAGATGGAGAACGGCGACGAGGAGGATCTAGCGCCCATCGGGGGAGTGGATGAGGGCGAGAACGAGAGCTT
GGAAGAGGAGATGATGGTTCTCAGTGAGGCCAAGAGACAGGATCTCGTGGTTCGGTTCAAGAAGACGGCCGATGG
TGTCTATGTCGAGGCTAAGAGGAGTGCTATCGGCGGGGTGGCGCAAGTGCCGTGGTATTTCTATGGGCTGCTCAT
GGCACTGGGGTGGAACGAGTTTTATATGGGTGAGTCTTGTTCCGCGAAGTCTGATGAATGTCTGCTGACGGTGTC
TGCTTCCGGTGTTAGTCCTACGAAACCCGTTCCTATGCATCCTACTCCTGCTAATGGCCGGCGGGACGTATGTCG
CTTACACGCTCAACCTTGTAGGCCCGATGATGCAGATGGGCAACGCGGCCGTTAACCAGGGCATCGACATCGCCA
AGCAGCAACTGCGCGACTTCATCGTCAACTCGGAGACGGCCAGACAGGCATTGGCCGTTCCATCTTCGTCGTCGG
ACACGCGCTTGGACGCGCTCGACGGGCGGGGGAAGAAAGTGAACGGTGACGATGGGGGGGATGATGGGGATGATG
GGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail