Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06603
Gene name
Locationscaffold_08:565830..566820
Strand+
Gene length (bp)990
Transcript length (bp)990
Coding sequence length (bp)990
Protein length (aa) 330

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01351 RNase_HII Ribonuclease HII 5.0E-41 51 272

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5158 0.7267 0.0272 0.0026 0.3119 0.0078 0.1053 0.129 0.0821 0.071

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2091
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7852
Ophiocordyceps australis map64 (Brazil) OphauB2|6510
Ophiocordyceps camponoti-floridani Ophcf2|06603 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7375
Ophiocordyceps kimflemingae Ophio5|5806
Ophiocordyceps subramaniannii Hirsu2|2458

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06603
MEPSSGTENPPSEAFTPPSIYPQPLTTGSSYTHLSPIPPALLADPRPPCALGIDEAGRGPALGPMVYAALAVPLS
SSTQLLRESHAFDDSKALTPAVRNRLMHALCSSASDLFESCAWAVSVLSARDISAEMMRPAGPHTLNAQAFDATV
HLIRQLCDAGVNVREIFVDAVGPPVPYQIRLQRLFPTASVVVANKADSLFPCVSAASICAKVTRDAALEHLYAAR
RPPSESPSSPPSWGSGYPSDARCVTWMKTNMNPVFGWGPECRFSWSTAKDMLDDGKTGAVKVDWPLPSDAHSSRV
TDFFLPSADERGSDELGSWFGTSVGVDAL*
Coding >Ophcf2|06603
ATGGAACCCAGCAGCGGCACAGAAAATCCCCCCTCCGAAGCCTTCACCCCTCCATCCATCTACCCTCAACCCCTC
ACCACCGGCTCGTCCTACACCCATCTCTCCCCCATCCCACCAGCCCTCCTCGCCGACCCCCGCCCCCCATGCGCC
CTCGGCATCGACGAAGCCGGCCGCGGCCCTGCGCTGGGACCCATGGTCTACGCCGCGCTGGCGGTGCCGTTATCC
TCCTCGACGCAGCTTCTCCGCGAGTCGCACGCCTTTGACGACTCCAAGGCTCTGACGCCCGCCGTTCGTAACCGC
TTGATGCACGCGCTCTGCTCGTCTGCTTCGGACCTCTTCGAGTCTTGCGCGTGGGCTGTTTCCGTGCTTTCGGCG
AGGGATATCTCGGCCGAGATGATGAGGCCTGCCGGTCCGCATACGCTCAATGCTCAGGCCTTTGACGCTACGGTC
CATCTGATACGCCAGCTGTGCGACGCCGGCGTCAACGTCCGTGAAATCTTCGTCGACGCCGTCGGCCCTCCCGTT
CCCTATCAAATCCGTCTGCAACGGCTGTTCCCCACGGCGTCTGTCGTCGTGGCAAACAAGGCAGATAGCCTCTTC
CCTTGCGTCAGCGCCGCCTCCATCTGCGCAAAAGTCACTCGCGACGCCGCTCTCGAGCATCTGTACGCCGCCCGA
CGCCCGCCATCGGAATCGCCGTCGTCGCCGCCGTCTTGGGGTTCGGGCTATCCCTCCGATGCTCGCTGCGTCACC
TGGATGAAGACCAATATGAACCCCGTCTTCGGCTGGGGTCCCGAGTGTCGCTTCAGCTGGAGCACGGCAAAGGAC
ATGCTCGATGACGGCAAGACCGGCGCCGTCAAGGTCGACTGGCCGCTGCCCTCCGATGCTCACTCGAGCCGTGTC
ACCGACTTTTTCCTGCCGAGCGCCGACGAGAGGGGATCGGACGAGCTGGGCTCCTGGTTCGGCACCTCGGTTGGT
GTTGACGCCTTGTAG
Transcript >Ophcf2|06603
ATGGAACCCAGCAGCGGCACAGAAAATCCCCCCTCCGAAGCCTTCACCCCTCCATCCATCTACCCTCAACCCCTC
ACCACCGGCTCGTCCTACACCCATCTCTCCCCCATCCCACCAGCCCTCCTCGCCGACCCCCGCCCCCCATGCGCC
CTCGGCATCGACGAAGCCGGCCGCGGCCCTGCGCTGGGACCCATGGTCTACGCCGCGCTGGCGGTGCCGTTATCC
TCCTCGACGCAGCTTCTCCGCGAGTCGCACGCCTTTGACGACTCCAAGGCTCTGACGCCCGCCGTTCGTAACCGC
TTGATGCACGCGCTCTGCTCGTCTGCTTCGGACCTCTTCGAGTCTTGCGCGTGGGCTGTTTCCGTGCTTTCGGCG
AGGGATATCTCGGCCGAGATGATGAGGCCTGCCGGTCCGCATACGCTCAATGCTCAGGCCTTTGACGCTACGGTC
CATCTGATACGCCAGCTGTGCGACGCCGGCGTCAACGTCCGTGAAATCTTCGTCGACGCCGTCGGCCCTCCCGTT
CCCTATCAAATCCGTCTGCAACGGCTGTTCCCCACGGCGTCTGTCGTCGTGGCAAACAAGGCAGATAGCCTCTTC
CCTTGCGTCAGCGCCGCCTCCATCTGCGCAAAAGTCACTCGCGACGCCGCTCTCGAGCATCTGTACGCCGCCCGA
CGCCCGCCATCGGAATCGCCGTCGTCGCCGCCGTCTTGGGGTTCGGGCTATCCCTCCGATGCTCGCTGCGTCACC
TGGATGAAGACCAATATGAACCCCGTCTTCGGCTGGGGTCCCGAGTGTCGCTTCAGCTGGAGCACGGCAAAGGAC
ATGCTCGATGACGGCAAGACCGGCGCCGTCAAGGTCGACTGGCCGCTGCCCTCCGATGCTCACTCGAGCCGTGTC
ACCGACTTTTTCCTGCCGAGCGCCGACGAGAGGGGATCGGACGAGCTGGGCTCCTGGTTCGGCACCTCGGTTGGT
GTTGACGCCTTGTAG
Gene >Ophcf2|06603
ATGGAACCCAGCAGCGGCACAGAAAATCCCCCCTCCGAAGCCTTCACCCCTCCATCCATCTACCCTCAACCCCTC
ACCACCGGCTCGTCCTACACCCATCTCTCCCCCATCCCACCAGCCCTCCTCGCCGACCCCCGCCCCCCATGCGCC
CTCGGCATCGACGAAGCCGGCCGCGGCCCTGCGCTGGGACCCATGGTCTACGCCGCGCTGGCGGTGCCGTTATCC
TCCTCGACGCAGCTTCTCCGCGAGTCGCACGCCTTTGACGACTCCAAGGCTCTGACGCCCGCCGTTCGTAACCGC
TTGATGCACGCGCTCTGCTCGTCTGCTTCGGACCTCTTCGAGTCTTGCGCGTGGGCTGTTTCCGTGCTTTCGGCG
AGGGATATCTCGGCCGAGATGATGAGGCCTGCCGGTCCGCATACGCTCAATGCTCAGGCCTTTGACGCTACGGTC
CATCTGATACGCCAGCTGTGCGACGCCGGCGTCAACGTCCGTGAAATCTTCGTCGACGCCGTCGGCCCTCCCGTT
CCCTATCAAATCCGTCTGCAACGGCTGTTCCCCACGGCGTCTGTCGTCGTGGCAAACAAGGCAGATAGCCTCTTC
CCTTGCGTCAGCGCCGCCTCCATCTGCGCAAAAGTCACTCGCGACGCCGCTCTCGAGCATCTGTACGCCGCCCGA
CGCCCGCCATCGGAATCGCCGTCGTCGCCGCCGTCTTGGGGTTCGGGCTATCCCTCCGATGCTCGCTGCGTCACC
TGGATGAAGACCAATATGAACCCCGTCTTCGGCTGGGGTCCCGAGTGTCGCTTCAGCTGGAGCACGGCAAAGGAC
ATGCTCGATGACGGCAAGACCGGCGCCGTCAAGGTCGACTGGCCGCTGCCCTCCGATGCTCACTCGAGCCGTGTC
ACCGACTTTTTCCTGCCGAGCGCCGACGAGAGGGGATCGGACGAGCTGGGCTCCTGGTTCGGCACCTCGGTTGGT
GTTGACGCCTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail