Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06602
Gene name
Locationscaffold_08:562589..565055
Strand-
Gene length (bp)2466
Transcript length (bp)2214
Coding sequence length (bp)2214
Protein length (aa) 738

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11699 CENP-C_C Mif2/CENP-C like 5.0E-34 631 715
PF15624 Mif2_N Kinetochore CENP-C fungal homologue, Mif2, N-terminal 9.8E-32 15 127

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.0962 0.9218 0.0822 0.0345 0.056 0.0114 0.0141 0.0033 0.0104 0.0098

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2090
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7851
Ophiocordyceps australis map64 (Brazil) OphauB2|6509
Ophiocordyceps camponoti-floridani Ophcf2|06602 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|391
Ophiocordyceps kimflemingae Ophio5|5807
Ophiocordyceps subramaniannii Hirsu2|2457

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06602
MPPRRRVEVPESQDFHELGHRGRKTGISLPDGGERDEHGMQPLENLFSSPLKPETNGNHDSGSEDMDISSSGGPG
PDTLLRNQRNAKLPVPRSRSPLKTTLGSPPRKMAPPRVVERVPSPADDASAPRSLQFDASFDDSADVTGPGPDPD
PLPTKPNGFGPNGVGDGSTLDLGNNSVEESVLLLDAVNRQNESFEEDSALAAVPASQDVTELEEQREEAPSQPAE
QPVKRRRGRPRRQDRPVDNSQSSQPTATKKRRSSRTSLVAEGNDADASQQAPIAQDQRKAKRQRTKGPSTATSMA
PPPLPPPERPAPAARYEVDEEEEADAAEAMEREHETKGTGARQKHAGRRQKTAETHNKHDEGQDRHLKHPEGPAD
KHAKRQNKHAEDGNLESRTSRAEKRRERAVAEPTDAELHKKKGADGRHKTVTASANKPGRAEAAENEDDDEDEEP
KPRRKGRPARKDKAPGDASFMALQRGPPMPKSRGLVSVRRDDEAMTLTRSGRHSYRPVQYWRGEQVICEDEEQND
MFHNRGDFVLPTIKEVVRVPPEAPPSKRGTRSGGRTRTKQGRQPEEEEELEEWEVSQGVMTGEVVIWEPEHEEHP
PGEDEPVQVMRDRIAISSDAIQTSDIKDATFRFAKTLTTPFMGSGVVDLPPGAEKRPKNSRKMHMVFFVHYGKVL
VTLNETQFRITAGGTWFVPRGNYYSITNDYDSPSRIFFAQACEVHPPRPDANDGSATDPTPS*
Coding >Ophcf2|06602
ATGCCTCCTCGTAGGCGCGTTGAGGTGCCTGAGTCTCAGGATTTTCATGAGCTGGGTCATCGAGGCCGGAAAACG
GGCATATCCCTCCCCGATGGCGGTGAACGAGACGAGCATGGAATGCAACCGCTCGAAAACCTCTTCTCGTCGCCC
CTCAAACCCGAGACAAACGGTAACCACGACTCGGGCAGCGAGGACATGGACATCTCTTCCAGTGGCGGCCCCGGG
CCCGACACGCTGCTGCGGAACCAGCGCAACGCCAAGCTTCCCGTGCCCCGGAGCCGGTCTCCGCTCAAGACGACG
CTCGGCTCTCCGCCGCGAAAGATGGCGCCTCCTCGCGTCGTGGAGCGCGTCCCGTCTCCGGCCGATGATGCTTCT
GCTCCTCGCAGCTTGCAGTTCGATGCCAGCTTCGACGATTCCGCCGACGTCACTGGTCCCGGTCCCGATCCCGAT
CCCCTTCCCACCAAACCAAACGGCTTCGGCCCCAACGGCGTCGGAGATGGCTCCACACTCGACCTCGGCAACAAC
TCGGTCGAGGAGTCTGTCCTTTTGCTCGACGCCGTGAATCGTCAGAACGAAAGCTTCGAAGAAGACTCCGCCCTT
GCCGCAGTACCCGCCTCCCAGGACGTCACCGAGCTCGAGGAACAGCGGGAGGAGGCCCCGTCGCAGCCGGCCGAG
CAGCCGGTCAAGCGCCGCAGGGGACGACCTCGGCGTCAAGACCGTCCGGTCGACAATTCGCAATCCTCCCAGCCG
ACGGCCACCAAGAAGAGACGGTCCTCGAGGACCTCACTCGTCGCCGAAGGCAACGATGCGGACGCCTCCCAACAG
GCCCCGATCGCCCAAGACCAGAGGAAGGCCAAGCGTCAGCGCACCAAAGGACCATCCACCGCGACCTCCATGGCG
CCACCTCCGCTTCCGCCTCCGGAGAGGCCGGCACCGGCAGCCCGGTACGAGGTCGACGAGGAGGAAGAGGCTGAT
GCCGCTGAAGCCATGGAGAGGGAGCACGAGACCAAGGGCACGGGAGCGCGACAGAAGCACGCGGGCCGACGGCAG
AAGACGGCAGAGACGCACAATAAGCACGACGAAGGCCAGGACAGGCACCTGAAGCACCCAGAAGGCCCAGCGGAC
AAGCACGCCAAGCGTCAGAACAAGCATGCCGAGGACGGAAACCTCGAATCGCGGACGTCGCGCGCAGAGAAGCGG
CGGGAGCGCGCTGTAGCTGAGCCCACGGACGCCGAATTACACAAGAAGAAGGGCGCAGATGGCCGCCACAAGACG
GTGACGGCATCCGCCAACAAACCGGGACGGGCAGAGGCGGCCGAAAACGAGGACGACGACGAGGACGAAGAGCCC
AAGCCCAGGCGAAAGGGCAGGCCGGCTCGCAAAGACAAGGCGCCGGGAGACGCGTCCTTCATGGCGCTGCAGCGT
GGCCCGCCCATGCCCAAGTCGCGCGGACTCGTGTCGGTCCGTCGCGACGACGAGGCCATGACGCTGACGCGGTCC
GGGCGACACTCGTACCGGCCGGTGCAGTACTGGAGAGGCGAGCAGGTGATTTGCGAGGACGAGGAGCAGAACGAC
ATGTTCCACAACCGCGGCGACTTTGTGCTGCCGACGATCAAGGAGGTGGTCCGGGTGCCTCCGGAAGCGCCTCCG
TCCAAGCGCGGGACCCGGAGCGGCGGCAGGACGCGGACCAAGCAAGGCCGGCAGCCGGAAGAGGAGGAGGAGCTG
GAGGAGTGGGAGGTCAGCCAGGGCGTCATGACGGGCGAGGTCGTCATCTGGGAGCCCGAGCACGAGGAGCATCCC
CCGGGCGAGGACGAGCCCGTGCAGGTGATGAGGGATCGGATCGCCATCTCGTCCGACGCCATCCAGACGTCGGAC
ATTAAGGACGCGACGTTCCGGTTCGCAAAGACGCTGACGACTCCGTTCATGGGCTCGGGAGTCGTGGATCTACCG
CCTGGCGCCGAGAAGCGGCCCAAGAATTCTCGCAAGATGCACATGGTCTTCTTCGTCCACTACGGAAAAGTCCTC
GTCACCCTCAACGAGACGCAATTCCGCATCACGGCCGGAGGAACATGGTTCGTCCCGCGAGGAAACTACTACAGC
ATCACAAACGACTACGACTCCCCCAGCCGCATCTTCTTCGCACAGGCATGCGAAGTCCACCCCCCGCGTCCCGAC
GCAAACGATGGATCCGCCACCGACCCGACGCCTTCTTGA
Transcript >Ophcf2|06602
ATGCCTCCTCGTAGGCGCGTTGAGGTGCCTGAGTCTCAGGATTTTCATGAGCTGGGTCATCGAGGCCGGAAAACG
GGCATATCCCTCCCCGATGGCGGTGAACGAGACGAGCATGGAATGCAACCGCTCGAAAACCTCTTCTCGTCGCCC
CTCAAACCCGAGACAAACGGTAACCACGACTCGGGCAGCGAGGACATGGACATCTCTTCCAGTGGCGGCCCCGGG
CCCGACACGCTGCTGCGGAACCAGCGCAACGCCAAGCTTCCCGTGCCCCGGAGCCGGTCTCCGCTCAAGACGACG
CTCGGCTCTCCGCCGCGAAAGATGGCGCCTCCTCGCGTCGTGGAGCGCGTCCCGTCTCCGGCCGATGATGCTTCT
GCTCCTCGCAGCTTGCAGTTCGATGCCAGCTTCGACGATTCCGCCGACGTCACTGGTCCCGGTCCCGATCCCGAT
CCCCTTCCCACCAAACCAAACGGCTTCGGCCCCAACGGCGTCGGAGATGGCTCCACACTCGACCTCGGCAACAAC
TCGGTCGAGGAGTCTGTCCTTTTGCTCGACGCCGTGAATCGTCAGAACGAAAGCTTCGAAGAAGACTCCGCCCTT
GCCGCAGTACCCGCCTCCCAGGACGTCACCGAGCTCGAGGAACAGCGGGAGGAGGCCCCGTCGCAGCCGGCCGAG
CAGCCGGTCAAGCGCCGCAGGGGACGACCTCGGCGTCAAGACCGTCCGGTCGACAATTCGCAATCCTCCCAGCCG
ACGGCCACCAAGAAGAGACGGTCCTCGAGGACCTCACTCGTCGCCGAAGGCAACGATGCGGACGCCTCCCAACAG
GCCCCGATCGCCCAAGACCAGAGGAAGGCCAAGCGTCAGCGCACCAAAGGACCATCCACCGCGACCTCCATGGCG
CCACCTCCGCTTCCGCCTCCGGAGAGGCCGGCACCGGCAGCCCGGTACGAGGTCGACGAGGAGGAAGAGGCTGAT
GCCGCTGAAGCCATGGAGAGGGAGCACGAGACCAAGGGCACGGGAGCGCGACAGAAGCACGCGGGCCGACGGCAG
AAGACGGCAGAGACGCACAATAAGCACGACGAAGGCCAGGACAGGCACCTGAAGCACCCAGAAGGCCCAGCGGAC
AAGCACGCCAAGCGTCAGAACAAGCATGCCGAGGACGGAAACCTCGAATCGCGGACGTCGCGCGCAGAGAAGCGG
CGGGAGCGCGCTGTAGCTGAGCCCACGGACGCCGAATTACACAAGAAGAAGGGCGCAGATGGCCGCCACAAGACG
GTGACGGCATCCGCCAACAAACCGGGACGGGCAGAGGCGGCCGAAAACGAGGACGACGACGAGGACGAAGAGCCC
AAGCCCAGGCGAAAGGGCAGGCCGGCTCGCAAAGACAAGGCGCCGGGAGACGCGTCCTTCATGGCGCTGCAGCGT
GGCCCGCCCATGCCCAAGTCGCGCGGACTCGTGTCGGTCCGTCGCGACGACGAGGCCATGACGCTGACGCGGTCC
GGGCGACACTCGTACCGGCCGGTGCAGTACTGGAGAGGCGAGCAGGTGATTTGCGAGGACGAGGAGCAGAACGAC
ATGTTCCACAACCGCGGCGACTTTGTGCTGCCGACGATCAAGGAGGTGGTCCGGGTGCCTCCGGAAGCGCCTCCG
TCCAAGCGCGGGACCCGGAGCGGCGGCAGGACGCGGACCAAGCAAGGCCGGCAGCCGGAAGAGGAGGAGGAGCTG
GAGGAGTGGGAGGTCAGCCAGGGCGTCATGACGGGCGAGGTCGTCATCTGGGAGCCCGAGCACGAGGAGCATCCC
CCGGGCGAGGACGAGCCCGTGCAGGTGATGAGGGATCGGATCGCCATCTCGTCCGACGCCATCCAGACGTCGGAC
ATTAAGGACGCGACGTTCCGGTTCGCAAAGACGCTGACGACTCCGTTCATGGGCTCGGGAGTCGTGGATCTACCG
CCTGGCGCCGAGAAGCGGCCCAAGAATTCTCGCAAGATGCACATGGTCTTCTTCGTCCACTACGGAAAAGTCCTC
GTCACCCTCAACGAGACGCAATTCCGCATCACGGCCGGAGGAACATGGTTCGTCCCGCGAGGAAACTACTACAGC
ATCACAAACGACTACGACTCCCCCAGCCGCATCTTCTTCGCACAGGCATGCGAAGTCCACCCCCCGCGTCCCGAC
GCAAACGATGGATCCGCCACCGACCCGACGCCTTCTTGA
Gene >Ophcf2|06602
ATGCCTCCTCGTAGGCGCGTTGAGGTGCCTGAGTCTCAGGATTTTCATGAGCTGGGTCATCGAGGCCGGTAAGAT
TTCGTCCTCTTTTTTTTTTTCATTTACTCAGGCGAGACGTGAAATGCAGGGCCCTTTCTCGCAGACGGGGGCCTC
CTCGACCAGCCAGCAGCTGACATTGAGCCGCTTAGGAAAACGGGCATATCCCTCCCCGATGGCGGTGAACGAGAC
GAGCATGGAATGCAACCGCTCGAAAACCTCTTCTCGTCGCCCCTCAAACCCGAGACAAACGGTAACCACGACTCG
GGCAGCGAGGACATGGACATCTCTTCCAGTACGCATGGGTCGCCGCCTGCCCGTCCTTCGTCGCCGCTGACTTCC
GACGGTCCAGGTGGCGGCCCCGGGCCCGACACGCTGCTGCGGAACCAGCGCAACGCCAAGCTTCCCGTGCCCCGG
AGCCGGTCTCCGCTCAAGACGACGCTCGGCTCTCCGCCGCGAAAGATGGCGCCTCCTCGCGTCGTGGAGCGCGTC
CCGTCTCCGGCCGATGATGCTTCTGCTCCTCGCAGCTTGCAGTTCGATGCCAGCTTCGACGATTCCGCCGACGTC
ACTGGTCCCGGTCCCGATCCCGATCCCCTTCCCACCAAACCAAACGGCTTCGGCCCCAACGGCGTCGGAGATGGC
TCCACACTCGACCTCGGCAACAACTCGGTCGAGGAGTCTGTCCTTTTGCTCGACGCCGTGAATCGTCAGAACGAA
AGCTTCGAAGAAGACTCCGCCCTTGCCGCAGTACCCGCCTCCCAGGACGTCACCGAGCTCGAGGAACAGCGGGAG
GAGGCCCCGTCGCAGCCGGCCGAGCAGCCGGTCAAGCGCCGCAGGGGACGACCTCGGCGTCAAGACCGTCCGGTC
GACAATTCGCAATCCTCCCAGCCGACGGCCACCAAGAAGAGACGGTCCTCGAGGACCTCACTCGTCGCCGAAGGC
AACGATGCGGACGCCTCCCAACAGGCCCCGATCGCCCAAGACCAGAGGAAGGCCAAGCGTCAGCGCACCAAAGGA
CCATCCACCGCGACCTCCATGGCGCCACCTCCGCTTCCGCCTCCGGAGAGGCCGGCACCGGCAGCCCGGTACGAG
GTCGACGAGGAGGAAGAGGCTGATGCCGCTGAAGCCATGGAGAGGGAGCACGAGACCAAGGGCACGGGAGCGCGA
CAGAAGCACGCGGGCCGACGGCAGAAGACGGCAGAGACGCACAATAAGCACGACGAAGGCCAGGACAGGCACCTG
AAGCACCCAGAAGGCCCAGCGGACAAGCACGCCAAGCGTCAGAACAAGCATGCCGAGGACGGAAACCTCGAATCG
CGGACGTCGCGCGCAGAGAAGCGGCGGGAGCGCGCTGTAGCTGAGCCCACGGACGCCGAATTACACAAGAAGAAG
GGCGCAGATGGCCGCCACAAGACGGTGACGGCATCCGCCAACAAACCGGGACGGGCAGAGGCGGCCGAAAACGAG
GACGACGACGAGGACGAAGAGCCCAAGCCCAGGCGAAAGGGCAGGCCGGCTCGCAAAGACAAGGCGCCGGGAGAC
GCGTCCTTCATGGCGCTGCAGCGTGGCCCGCCCATGCCCAAGTCGCGCGGACTCGTGTCGGTCCGTCGCGACGAC
GAGGCCATGACGCTGACGCGGTCCGGGCGACACTCGTACCGGCCGGTGCAGTACTGGAGAGGCGAGCAGGTGATT
TGCGAGGACGAGGAGCAGAACGACATGTTCCACAACCGCGGCGACTTTGTGCTGCCGACGATCAAGGAGGTGGTC
CGGGTGCCTCCGGAAGCGCCTCCGTCCAAGCGCGGGACCCGGAGCGGCGGCAGGACGCGGACCAAGCAAGGCCGG
CAGCCGGAAGAGGAGGAGGAGCTGGAGGAGTGGGAGGTCAGCCAGGGCGTCATGACGGGCGAGGTCGTCATCTGG
GAGCCCGAGCACGAGGAGCATCCCCCGGGCGAGGACGAGCCCGTGCAGGTGATGAGGGATCGGATCGCCATCTCG
TCCGACGCCATCCAGACGTCGGACATTAAGGACGCGACGTTCCGGTTCGCAAAGACGCTGACGACTCCGTTCATG
GGCTCGGGAGTCGTGGATCTACCGCCTGGCGCCGAGAAGCGGCCCAAGAATTCTCGCAAGATGCACATGGTCTTC
TTCGTCCACTACGGAAAAGTCCTCGTCACCCTCAACGAGACGCAATTCCGCATCACGGCCGGAGGAACATGGTTC
GTCCCGCGAGGTCGGTTGTTTCTCGATTTCCCATCTATCCAATCTTGGTATCACTTCCCACTGACCTTTCTTTCT
TTCCCCTTTGCAGGAAACTACTACAGCATCACAAACGACTACGACTCCCCCAGCCGCATCTTCTTCGCACAGGCA
TGCGAAGTCCACCCCCCGCGTCCCGACGCAAACGATGGATCCGCCACCGACCCGACGCCTTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail