Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06599
Gene name
Locationscaffold_08:555701..557666
Strand+
Gene length (bp)1965
Transcript length (bp)1965
Coding sequence length (bp)1965
Protein length (aa) 655

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 1.8E-258 6 612
PF06723 MreB_Mbl MreB/Mbl protein 1.7E-16 138 374

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0140662 ATP-dependent protein folding chaperone Yes
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0044183 protein folding chaperone No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7211 0.5114 0.4268 0.1394 0.066 0.0054 0.3197 0.03 0.09 0.0053

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup19
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6827
Ophiocordyceps australis 1348a (Ghana) OphauG2|1285
Ophiocordyceps australis 1348a (Ghana) OphauG2|549
Ophiocordyceps australis 1348a (Ghana) OphauG2|6323
Ophiocordyceps australis map64 (Brazil) OphauB2|2768
Ophiocordyceps australis map64 (Brazil) OphauB2|4442
Ophiocordyceps australis map64 (Brazil) OphauB2|6488
Ophiocordyceps australis map64 (Brazil) OphauB2|887
Ophiocordyceps camponoti-floridani Ophcf2|06599 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04175
Ophiocordyceps camponoti-floridani Ophcf2|01527
Ophiocordyceps camponoti-floridani Ophcf2|03359
Ophiocordyceps camponoti-rufipedis Ophun1|126
Ophiocordyceps camponoti-rufipedis Ophun1|1222
Ophiocordyceps camponoti-rufipedis Ophun1|5420
Ophiocordyceps camponoti-rufipedis Ophun1|4594
Ophiocordyceps kimflemingae Ophio5|2142
Ophiocordyceps kimflemingae Ophio5|48
Ophiocordyceps kimflemingae Ophio5|7217
Ophiocordyceps kimflemingae Ophio5|8068
Ophiocordyceps subramaniannii Hirsu2|8776
Ophiocordyceps subramaniannii Hirsu2|4859
Ophiocordyceps subramaniannii Hirsu2|4521
Ophiocordyceps subramaniannii Hirsu2|10451

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06599
MSMGPAVGIDLGTTYSCVGIFREDRCDIIANDQGNRTTPSFVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLIG
RKFADAEVQADMKHFPFKIIDKAGKPVIEVEFKGEKKTFTPEEISSMVLTKMRETAESYLGGTVNNAVVTVPAYF
NDSQRQATKDAGHIAGLNVLRIINEPTAAAIAYGLDKKVEGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGD
THLGGEDFDNRLVNHFVNEFKRKHKKDLSSNSRALRRLRTACERAKRTLSSSAQTSIEIDSLFEGIDFYTSITRA
RFEELCQDLFRSTIQPVDRVLADAKIDKSQVNEIVLVGGSTRIPRIQKLITDYFNGKEPNKSINPDEAVAYGAAV
QAAILSGDTSSKSTNEILLLDVAPLSLGIETAGGMMTKLIPRNTTIPTKKSEVFSTFSDNQPGVLIQVYEGERQR
TKDNNLLGKFELTGIPPAPRGVPQIEVTFDLDANGIMNVSAHEKGTGKSNKIVITNDKGRLSKEEIERMLAEAEK
FKEEDEAEGTRVAAKNGLESYAYSLRNTLSDPKVDEKIEAGDKETLKTEIDKIVAWLDDNQQATREEYEEHQKEL
EGVANPIMMKFYGAGGEGAGMPGMPGGGPGGFPGAGGAPHGAGGDDGPTVEEVD*
Coding >Ophcf2|06599
ATGTCCATGGGCCCAGCCGTCGGTATCGACCTCGGTACCACGTACTCGTGCGTGGGCATCTTCCGAGAGGATCGC
TGCGACATCATCGCCAACGACCAGGGCAACCGGACCACTCCCTCGTTCGTCGCCTTCACCGACACGGAGCGTCTG
ATTGGAGATGCCGCCAAGAACCAGGTGGCCATGAACCCTCACAACACCGTCTTCGACGCCAAGCGGTTGATCGGT
CGCAAGTTTGCCGACGCCGAGGTCCAAGCCGACATGAAGCACTTCCCCTTCAAGATCATCGACAAGGCCGGCAAG
CCCGTCATCGAGGTTGAGTTCAAGGGCGAGAAGAAGACGTTTACCCCCGAGGAGATCTCCTCCATGGTCTTGACC
AAGATGCGTGAGACTGCCGAGAGCTACCTGGGCGGCACCGTCAACAACGCCGTCGTCACCGTCCCTGCCTACTTC
AACGACAGCCAGCGCCAGGCCACCAAGGATGCTGGTCACATTGCCGGCCTCAACGTTCTGCGTATCATCAACGAG
CCCACGGCTGCTGCCATCGCCTACGGCCTCGACAAGAAGGTCGAGGGCGAGCGTAACGTCCTCATCTTTGACCTC
GGTGGCGGTACCTTTGATGTCTCTCTCCTCACCATCGAGGAAGGCATCTTTGAAGTTAAGTCGACTGCTGGCGAT
ACCCACCTGGGTGGCGAGGACTTTGACAACCGTCTCGTCAACCACTTTGTCAACGAGTTCAAGCGCAAGCACAAG
AAGGACCTGTCTTCCAACAGCCGCGCCCTGCGTCGTCTCCGCACCGCCTGCGAGCGCGCCAAGCGTACCCTCTCG
TCGTCGGCCCAGACGTCCATCGAGATTGACTCTCTCTTCGAGGGCATCGACTTCTACACCTCCATCACGCGCGCT
CGCTTCGAGGAGCTCTGCCAGGACCTCTTCCGCTCCACCATCCAGCCCGTTGATCGCGTCCTCGCCGATGCCAAG
ATCGACAAGAGCCAGGTCAACGAGATCGTCCTCGTCGGCGGCTCGACCCGCATCCCGCGCATCCAGAAGCTCATC
ACCGACTACTTCAACGGCAAGGAGCCCAACAAGTCCATCAACCCCGACGAGGCCGTCGCCTATGGTGCTGCTGTC
CAGGCCGCCATCCTGTCTGGCGACACGTCGTCCAAGTCGACCAACGAGATCCTGCTTCTCGATGTCGCTCCCCTG
TCTCTCGGTATCGAGACTGCCGGTGGCATGATGACGAAGCTCATCCCCCGCAACACCACCATCCCTACCAAGAAG
TCCGAGGTCTTCTCCACCTTCTCCGACAACCAGCCGGGTGTCCTCATCCAGGTCTACGAGGGTGAGCGCCAGCGC
ACCAAGGACAACAACCTGCTCGGCAAATTCGAGCTCACCGGTATCCCTCCTGCGCCCCGCGGTGTCCCCCAGATC
GAGGTCACCTTCGACCTCGATGCCAATGGCATCATGAACGTCTCCGCCCACGAGAAGGGCACGGGCAAGTCCAAC
AAGATTGTCATCACCAACGACAAGGGCCGCCTGTCCAAGGAGGAGATTGAGCGCATGTTGGCCGAGGCCGAGAAG
TTCAAGGAGGAGGATGAGGCCGAGGGCACCCGCGTGGCTGCCAAGAATGGTCTCGAGTCGTATGCTTACTCGCTG
CGGAACACGCTGTCCGACCCCAAGGTGGACGAGAAGATTGAGGCGGGCGACAAGGAGACGCTCAAGACGGAGATT
GACAAGATCGTCGCCTGGCTCGACGACAACCAGCAGGCGACTCGCGAGGAGTACGAGGAGCACCAGAAGGAGCTC
GAGGGCGTCGCCAACCCCATCATGATGAAGTTCTACGGAGCTGGCGGCGAGGGTGCCGGCATGCCCGGAATGCCT
GGTGGCGGTCCCGGCGGTTTCCCCGGAGCCGGCGGCGCTCCCCACGGCGCTGGAGGCGACGACGGTCCCACGGTG
GAGGAGGTTGACTAA
Transcript >Ophcf2|06599
ATGTCCATGGGCCCAGCCGTCGGTATCGACCTCGGTACCACGTACTCGTGCGTGGGCATCTTCCGAGAGGATCGC
TGCGACATCATCGCCAACGACCAGGGCAACCGGACCACTCCCTCGTTCGTCGCCTTCACCGACACGGAGCGTCTG
ATTGGAGATGCCGCCAAGAACCAGGTGGCCATGAACCCTCACAACACCGTCTTCGACGCCAAGCGGTTGATCGGT
CGCAAGTTTGCCGACGCCGAGGTCCAAGCCGACATGAAGCACTTCCCCTTCAAGATCATCGACAAGGCCGGCAAG
CCCGTCATCGAGGTTGAGTTCAAGGGCGAGAAGAAGACGTTTACCCCCGAGGAGATCTCCTCCATGGTCTTGACC
AAGATGCGTGAGACTGCCGAGAGCTACCTGGGCGGCACCGTCAACAACGCCGTCGTCACCGTCCCTGCCTACTTC
AACGACAGCCAGCGCCAGGCCACCAAGGATGCTGGTCACATTGCCGGCCTCAACGTTCTGCGTATCATCAACGAG
CCCACGGCTGCTGCCATCGCCTACGGCCTCGACAAGAAGGTCGAGGGCGAGCGTAACGTCCTCATCTTTGACCTC
GGTGGCGGTACCTTTGATGTCTCTCTCCTCACCATCGAGGAAGGCATCTTTGAAGTTAAGTCGACTGCTGGCGAT
ACCCACCTGGGTGGCGAGGACTTTGACAACCGTCTCGTCAACCACTTTGTCAACGAGTTCAAGCGCAAGCACAAG
AAGGACCTGTCTTCCAACAGCCGCGCCCTGCGTCGTCTCCGCACCGCCTGCGAGCGCGCCAAGCGTACCCTCTCG
TCGTCGGCCCAGACGTCCATCGAGATTGACTCTCTCTTCGAGGGCATCGACTTCTACACCTCCATCACGCGCGCT
CGCTTCGAGGAGCTCTGCCAGGACCTCTTCCGCTCCACCATCCAGCCCGTTGATCGCGTCCTCGCCGATGCCAAG
ATCGACAAGAGCCAGGTCAACGAGATCGTCCTCGTCGGCGGCTCGACCCGCATCCCGCGCATCCAGAAGCTCATC
ACCGACTACTTCAACGGCAAGGAGCCCAACAAGTCCATCAACCCCGACGAGGCCGTCGCCTATGGTGCTGCTGTC
CAGGCCGCCATCCTGTCTGGCGACACGTCGTCCAAGTCGACCAACGAGATCCTGCTTCTCGATGTCGCTCCCCTG
TCTCTCGGTATCGAGACTGCCGGTGGCATGATGACGAAGCTCATCCCCCGCAACACCACCATCCCTACCAAGAAG
TCCGAGGTCTTCTCCACCTTCTCCGACAACCAGCCGGGTGTCCTCATCCAGGTCTACGAGGGTGAGCGCCAGCGC
ACCAAGGACAACAACCTGCTCGGCAAATTCGAGCTCACCGGTATCCCTCCTGCGCCCCGCGGTGTCCCCCAGATC
GAGGTCACCTTCGACCTCGATGCCAATGGCATCATGAACGTCTCCGCCCACGAGAAGGGCACGGGCAAGTCCAAC
AAGATTGTCATCACCAACGACAAGGGCCGCCTGTCCAAGGAGGAGATTGAGCGCATGTTGGCCGAGGCCGAGAAG
TTCAAGGAGGAGGATGAGGCCGAGGGCACCCGCGTGGCTGCCAAGAATGGTCTCGAGTCGTATGCTTACTCGCTG
CGGAACACGCTGTCCGACCCCAAGGTGGACGAGAAGATTGAGGCGGGCGACAAGGAGACGCTCAAGACGGAGATT
GACAAGATCGTCGCCTGGCTCGACGACAACCAGCAGGCGACTCGCGAGGAGTACGAGGAGCACCAGAAGGAGCTC
GAGGGCGTCGCCAACCCCATCATGATGAAGTTCTACGGAGCTGGCGGCGAGGGTGCCGGCATGCCCGGAATGCCT
GGTGGCGGTCCCGGCGGTTTCCCCGGAGCCGGCGGCGCTCCCCACGGCGCTGGAGGCGACGACGGTCCCACGGTG
GAGGAGGTTGACTAA
Gene >Ophcf2|06599
ATGTCCATGGGCCCAGCCGTCGGTATCGACCTCGGTACCACGTACTCGTGCGTGGGCATCTTCCGAGAGGATCGC
TGCGACATCATCGCCAACGACCAGGGCAACCGGACCACTCCCTCGTTCGTCGCCTTCACCGACACGGAGCGTCTG
ATTGGAGATGCCGCCAAGAACCAGGTGGCCATGAACCCTCACAACACCGTCTTCGACGCCAAGCGGTTGATCGGT
CGCAAGTTTGCCGACGCCGAGGTCCAAGCCGACATGAAGCACTTCCCCTTCAAGATCATCGACAAGGCCGGCAAG
CCCGTCATCGAGGTTGAGTTCAAGGGCGAGAAGAAGACGTTTACCCCCGAGGAGATCTCCTCCATGGTCTTGACC
AAGATGCGTGAGACTGCCGAGAGCTACCTGGGCGGCACCGTCAACAACGCCGTCGTCACCGTCCCTGCCTACTTC
AACGACAGCCAGCGCCAGGCCACCAAGGATGCTGGTCACATTGCCGGCCTCAACGTTCTGCGTATCATCAACGAG
CCCACGGCTGCTGCCATCGCCTACGGCCTCGACAAGAAGGTCGAGGGCGAGCGTAACGTCCTCATCTTTGACCTC
GGTGGCGGTACCTTTGATGTCTCTCTCCTCACCATCGAGGAAGGCATCTTTGAAGTTAAGTCGACTGCTGGCGAT
ACCCACCTGGGTGGCGAGGACTTTGACAACCGTCTCGTCAACCACTTTGTCAACGAGTTCAAGCGCAAGCACAAG
AAGGACCTGTCTTCCAACAGCCGCGCCCTGCGTCGTCTCCGCACCGCCTGCGAGCGCGCCAAGCGTACCCTCTCG
TCGTCGGCCCAGACGTCCATCGAGATTGACTCTCTCTTCGAGGGCATCGACTTCTACACCTCCATCACGCGCGCT
CGCTTCGAGGAGCTCTGCCAGGACCTCTTCCGCTCCACCATCCAGCCCGTTGATCGCGTCCTCGCCGATGCCAAG
ATCGACAAGAGCCAGGTCAACGAGATCGTCCTCGTCGGCGGCTCGACCCGCATCCCGCGCATCCAGAAGCTCATC
ACCGACTACTTCAACGGCAAGGAGCCCAACAAGTCCATCAACCCCGACGAGGCCGTCGCCTATGGTGCTGCTGTC
CAGGCCGCCATCCTGTCTGGCGACACGTCGTCCAAGTCGACCAACGAGATCCTGCTTCTCGATGTCGCTCCCCTG
TCTCTCGGTATCGAGACTGCCGGTGGCATGATGACGAAGCTCATCCCCCGCAACACCACCATCCCTACCAAGAAG
TCCGAGGTCTTCTCCACCTTCTCCGACAACCAGCCGGGTGTCCTCATCCAGGTCTACGAGGGTGAGCGCCAGCGC
ACCAAGGACAACAACCTGCTCGGCAAATTCGAGCTCACCGGTATCCCTCCTGCGCCCCGCGGTGTCCCCCAGATC
GAGGTCACCTTCGACCTCGATGCCAATGGCATCATGAACGTCTCCGCCCACGAGAAGGGCACGGGCAAGTCCAAC
AAGATTGTCATCACCAACGACAAGGGCCGCCTGTCCAAGGAGGAGATTGAGCGCATGTTGGCCGAGGCCGAGAAG
TTCAAGGAGGAGGATGAGGCCGAGGGCACCCGCGTGGCTGCCAAGAATGGTCTCGAGTCGTATGCTTACTCGCTG
CGGAACACGCTGTCCGACCCCAAGGTGGACGAGAAGATTGAGGCGGGCGACAAGGAGACGCTCAAGACGGAGATT
GACAAGATCGTCGCCTGGCTCGACGACAACCAGCAGGCGACTCGCGAGGAGTACGAGGAGCACCAGAAGGAGCTC
GAGGGCGTCGCCAACCCCATCATGATGAAGTTCTACGGAGCTGGCGGCGAGGGTGCCGGCATGCCCGGAATGCCT
GGTGGCGGTCCCGGCGGTTTCCCCGGAGCCGGCGGCGCTCCCCACGGCGCTGGAGGCGACGACGGTCCCACGGTG
GAGGAGGTTGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail