Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06591
Gene name
Locationscaffold_08:530788..533297
Strand-
Gene length (bp)2509
Transcript length (bp)2193
Coding sequence length (bp)2193
Protein length (aa) 731

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00806 PUF Pumilio-family RNA binding repeat 6.4E-09 354 386
PF00806 PUF Pumilio-family RNA binding repeat 7.7E-09 390 421
PF00806 PUF Pumilio-family RNA binding repeat 6.4E-07 427 459
PF00806 PUF Pumilio-family RNA binding repeat 6.2E-05 463 495
PF00806 PUF Pumilio-family RNA binding repeat 5.0E-12 499 533
PF00806 PUF Pumilio-family RNA binding repeat 1.6E-01 540 554
PF00806 PUF Pumilio-family RNA binding repeat 1.1E-07 574 605
PF00806 PUF Pumilio-family RNA binding repeat 3.9E-04 616 642

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.8172 0.3085 0.1331 0.0618 0.1109 0.0022 0.0876 0.0857 0.0431 0.0117

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4411
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1291
Ophiocordyceps australis map64 (Brazil) OphauB2|6482
Ophiocordyceps camponoti-floridani Ophcf2|06591 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4658
Ophiocordyceps kimflemingae Ophio5|4213
Ophiocordyceps subramaniannii Hirsu2|9127

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06591
MPVTRSRNGLYDMNLDQTNTTRFLFGDDEPKALPRGQTPDESFPTLVRREDQMLSASSAALDLALSPSPKPELPG
ANGWNRVNRHRTQQSLSSINGSSSTQASELATPGSRPSSLDINYLAGSAAEPTVGNILPSQSHPTMAATPPRLQS
SFSANDVPTMKNPAGPMMSTNANSHAQQHFHNHNASIGRIPAGAVPNRGHNRDLSNDANAANGREQGTAAYPSIQ
SALQASAPAFGPTLTTASPLMPAAAPNSSAALGHFHAAFYPANNYAANAATASFGVPMLTAGMQQMGISGVNGGT
VYSAQNYTGFGSMPYSQGAQSRDSQARVMQTRRQLDSEAMSRYNNMPLESFRGQIYELCKDQHGCRYLQKKLEER
EADQVKVILQETKQHVTELMMDPFGNYLCQKLLEFCNDDERTVLIQNASQDMVRIALNQHGTRALQKMIEFVGTA
QQVRLIIEALRFRVVELIQDLNGNHVIQKCLNKLGASDAQFIFDAVGSNCVDVGTHRHGCCVLQRCIDHASGHQK
AWLVERITDHARVLVQDPFGNYVVQYIIDLNEPGFTDPVVRSFKGCIGSLSRHKFSSNVVEKCLRCAGPESKDMI
VDELLAPQEIERHLRDSFGNYVIQTAVEFATPHQKYRLVEAIRPLLPQIRNTPYGRRIQAKIAQYDNRGIAASSG
QATPADNTQGQISIRTAHTRATSNGRPVYAFQPTQFAYSPAHPVNDAAEGEPQWL*
Coding >Ophcf2|06591
ATGCCCGTGACGAGATCGCGAAACGGCTTGTACGACATGAACCTCGATCAGACCAACACGACGCGCTTCCTCTTT
GGCGATGACGAGCCAAAGGCCCTCCCTCGCGGCCAGACACCGGATGAGAGCTTCCCTACCCTCGTCAGGCGCGAA
GATCAGATGCTGTCTGCCTCTTCTGCAGCTCTCGATCTTGCCCTTTCCCCCTCTCCCAAGCCCGAGCTCCCAGGA
GCCAACGGTTGGAACCGCGTTAACCGCCATCGAACGCAGCAGAGCCTCTCCTCCATCAACGGCTCGTCTTCGACG
CAAGCGAGCGAGCTGGCCACTCCCGGAAGTCGTCCGTCGTCCCTCGACATCAACTACCTGGCAGGGAGCGCAGCC
GAGCCGACGGTCGGTAATATCCTGCCCTCTCAGAGCCATCCTACCATGGCCGCAACGCCGCCGAGACTGCAGAGT
TCTTTCTCTGCTAACGATGTGCCGACGATGAAGAACCCGGCTGGCCCGATGATGAGCACCAACGCCAACAGCCAC
GCTCAGCAGCACTTTCATAATCACAATGCCAGCATCGGCCGCATCCCCGCTGGAGCTGTTCCGAACCGCGGCCAC
AACCGAGATCTTTCCAACGACGCCAACGCAGCCAACGGCCGCGAGCAGGGCACCGCCGCATACCCTTCGATCCAG
TCGGCTCTCCAGGCCAGCGCCCCTGCTTTCGGACCGACGCTCACCACTGCATCGCCCCTGATGCCGGCCGCGGCG
CCCAACAGCTCGGCCGCCTTGGGCCACTTTCACGCGGCCTTCTACCCGGCCAACAACTACGCGGCCAATGCGGCC
ACGGCCAGCTTCGGCGTGCCCATGCTCACGGCCGGCATGCAGCAGATGGGCATCAGCGGCGTCAACGGCGGCACC
GTCTACTCGGCGCAGAACTATACGGGCTTCGGCTCGATGCCCTACAGCCAGGGCGCGCAGTCCCGCGACAGCCAG
GCACGCGTGATGCAGACGCGTCGCCAGCTGGACAGTGAAGCAATGTCGCGCTACAACAACATGCCGCTCGAATCT
TTCCGAGGCCAGATCTACGAGCTCTGCAAGGACCAGCACGGATGCCGCTACCTGCAGAAGAAGCTCGAGGAGCGA
GAGGCCGATCAGGTCAAGGTGATCTTGCAGGAGACGAAGCAGCACGTGACGGAGCTCATGATGGACCCGTTTGGC
AACTATCTGTGCCAGAAGCTCCTCGAGTTCTGCAACGACGACGAGCGGACGGTCCTGATCCAGAACGCGTCCCAG
GACATGGTGCGCATCGCCCTCAACCAGCACGGCACGCGGGCTCTGCAGAAGATGATCGAGTTCGTCGGCACGGCT
CAGCAGGTGCGGCTCATCATCGAGGCTCTCCGGTTCCGGGTCGTGGAGCTCATCCAGGACCTCAACGGCAACCAT
GTGATTCAGAAGTGCCTGAACAAGCTGGGGGCCAGCGATGCCCAGTTCATCTTTGACGCCGTGGGCAGCAACTGC
GTCGATGTCGGCACCCATCGCCACGGCTGCTGTGTTCTCCAGCGCTGCATCGACCACGCCTCGGGTCACCAGAAG
GCCTGGCTTGTTGAGCGCATCACGGACCACGCGCGTGTGCTCGTGCAGGATCCCTTTGGCAACTACGTCGTTCAG
TACATCATCGACCTCAACGAGCCAGGCTTCACCGATCCCGTCGTCCGCTCCTTCAAGGGCTGTATCGGTTCGCTG
TCGCGTCACAAGTTCAGCTCCAACGTGGTGGAGAAGTGCCTGCGCTGCGCGGGTCCCGAGTCCAAGGACATGATT
GTCGACGAGCTGCTCGCGCCTCAGGAGATTGAGCGTCACCTTCGCGACTCGTTCGGCAACTACGTCATCCAGACG
GCCGTCGAGTTCGCGACACCTCACCAAAAGTACCGCCTGGTCGAGGCCATCCGCCCCCTGCTGCCCCAGATCCGC
AACACGCCTTATGGCCGTCGAATCCAGGCCAAGATCGCCCAGTACGACAACCGCGGAATCGCAGCCTCAAGCGGC
CAGGCGACTCCCGCAGACAACACGCAGGGCCAAATCTCCATCCGCACCGCCCACACGCGAGCCACCAGCAACGGC
CGCCCCGTCTATGCCTTTCAGCCCACTCAGTTTGCCTACTCGCCCGCTCACCCCGTCAACGACGCTGCCGAGGGC
GAACCCCAGTGGCTCTAG
Transcript >Ophcf2|06591
ATGCCCGTGACGAGATCGCGAAACGGCTTGTACGACATGAACCTCGATCAGACCAACACGACGCGCTTCCTCTTT
GGCGATGACGAGCCAAAGGCCCTCCCTCGCGGCCAGACACCGGATGAGAGCTTCCCTACCCTCGTCAGGCGCGAA
GATCAGATGCTGTCTGCCTCTTCTGCAGCTCTCGATCTTGCCCTTTCCCCCTCTCCCAAGCCCGAGCTCCCAGGA
GCCAACGGTTGGAACCGCGTTAACCGCCATCGAACGCAGCAGAGCCTCTCCTCCATCAACGGCTCGTCTTCGACG
CAAGCGAGCGAGCTGGCCACTCCCGGAAGTCGTCCGTCGTCCCTCGACATCAACTACCTGGCAGGGAGCGCAGCC
GAGCCGACGGTCGGTAATATCCTGCCCTCTCAGAGCCATCCTACCATGGCCGCAACGCCGCCGAGACTGCAGAGT
TCTTTCTCTGCTAACGATGTGCCGACGATGAAGAACCCGGCTGGCCCGATGATGAGCACCAACGCCAACAGCCAC
GCTCAGCAGCACTTTCATAATCACAATGCCAGCATCGGCCGCATCCCCGCTGGAGCTGTTCCGAACCGCGGCCAC
AACCGAGATCTTTCCAACGACGCCAACGCAGCCAACGGCCGCGAGCAGGGCACCGCCGCATACCCTTCGATCCAG
TCGGCTCTCCAGGCCAGCGCCCCTGCTTTCGGACCGACGCTCACCACTGCATCGCCCCTGATGCCGGCCGCGGCG
CCCAACAGCTCGGCCGCCTTGGGCCACTTTCACGCGGCCTTCTACCCGGCCAACAACTACGCGGCCAATGCGGCC
ACGGCCAGCTTCGGCGTGCCCATGCTCACGGCCGGCATGCAGCAGATGGGCATCAGCGGCGTCAACGGCGGCACC
GTCTACTCGGCGCAGAACTATACGGGCTTCGGCTCGATGCCCTACAGCCAGGGCGCGCAGTCCCGCGACAGCCAG
GCACGCGTGATGCAGACGCGTCGCCAGCTGGACAGTGAAGCAATGTCGCGCTACAACAACATGCCGCTCGAATCT
TTCCGAGGCCAGATCTACGAGCTCTGCAAGGACCAGCACGGATGCCGCTACCTGCAGAAGAAGCTCGAGGAGCGA
GAGGCCGATCAGGTCAAGGTGATCTTGCAGGAGACGAAGCAGCACGTGACGGAGCTCATGATGGACCCGTTTGGC
AACTATCTGTGCCAGAAGCTCCTCGAGTTCTGCAACGACGACGAGCGGACGGTCCTGATCCAGAACGCGTCCCAG
GACATGGTGCGCATCGCCCTCAACCAGCACGGCACGCGGGCTCTGCAGAAGATGATCGAGTTCGTCGGCACGGCT
CAGCAGGTGCGGCTCATCATCGAGGCTCTCCGGTTCCGGGTCGTGGAGCTCATCCAGGACCTCAACGGCAACCAT
GTGATTCAGAAGTGCCTGAACAAGCTGGGGGCCAGCGATGCCCAGTTCATCTTTGACGCCGTGGGCAGCAACTGC
GTCGATGTCGGCACCCATCGCCACGGCTGCTGTGTTCTCCAGCGCTGCATCGACCACGCCTCGGGTCACCAGAAG
GCCTGGCTTGTTGAGCGCATCACGGACCACGCGCGTGTGCTCGTGCAGGATCCCTTTGGCAACTACGTCGTTCAG
TACATCATCGACCTCAACGAGCCAGGCTTCACCGATCCCGTCGTCCGCTCCTTCAAGGGCTGTATCGGTTCGCTG
TCGCGTCACAAGTTCAGCTCCAACGTGGTGGAGAAGTGCCTGCGCTGCGCGGGTCCCGAGTCCAAGGACATGATT
GTCGACGAGCTGCTCGCGCCTCAGGAGATTGAGCGTCACCTTCGCGACTCGTTCGGCAACTACGTCATCCAGACG
GCCGTCGAGTTCGCGACACCTCACCAAAAGTACCGCCTGGTCGAGGCCATCCGCCCCCTGCTGCCCCAGATCCGC
AACACGCCTTATGGCCGTCGAATCCAGGCCAAGATCGCCCAGTACGACAACCGCGGAATCGCAGCCTCAAGCGGC
CAGGCGACTCCCGCAGACAACACGCAGGGCCAAATCTCCATCCGCACCGCCCACACGCGAGCCACCAGCAACGGC
CGCCCCGTCTATGCCTTTCAGCCCACTCAGTTTGCCTACTCGCCCGCTCACCCCGTCAACGACGCTGCCGAGGGC
GAACCCCAGTGGCTCTAG
Gene >Ophcf2|06591
ATGCCCGTGACGAGATCGCGAAACGGCTTGTACGACATGAACCTCGATCAGACCAACACGACGCGCTTCCTCTTT
GGCGATGACGAGCCAAAGGCCCTCCCTCGCGGCCAGACACCGGATGAGAGCTTCCCTACCCTCGTCAGGCGCGAA
GATCAGATGGTGGGTTTTTTTTTTTCCCCTGTAATCTTGTTCCCTTGTCTCCTGTGGCCGCGTGCTGCTCGCCTG
TGGCTGGTAAAAACGGAGGCAACCAACGTTGACTCTCTGGGTTTCCGTTTTGCAACCGTTACCTGCCTCGAGTCA
CCCCACTGTTTAGTTTCCTGTTTTTGTTTTCTTCCAAGTCGCTTTTCTTTCTCACGCACGAGGCGGCTAAGGAAA
CATCTCGTCCTTGGCTTTCCTTCTGACACTTCTTCTCGCCTAGCTGTCTGCCTCTTCTGCAGCTCTCGATCTTGC
CCTTTCCCCCTCTCCCAAGCCCGAGCTCCCAGGAGCCAACGGTTGGAACCGCGTTAACCGCCATCGAACGCAGCA
GAGCCTCTCCTCCATCAACGGCTCGTCTTCGACGCAAGCGAGCGAGCTGGCCACTCCCGGAAGTCGTCCGTCGTC
CCTCGACATCAACTACCTGGCAGGGAGCGCAGCCGAGCCGACGGTCGGTAATATCCTGCCCTCTCAGAGCCATCC
TACCATGGCCGCAACGCCGCCGAGACTGCAGAGTTCTTTCTCTGCTAACGATGTGCCGACGATGAAGAACCCGGC
TGGCCCGATGATGAGCACCAACGCCAACAGCCACGCTCAGCAGCACTTTCATAATCACAATGCCAGCATCGGCCG
CATCCCCGCTGGAGCTGTTCCGAACCGCGGCCACAACCGAGATCTTTCCAACGACGCCAACGCAGCCAACGGCCG
CGAGCAGGGCACCGCCGCATACCCTTCGATCCAGTCGGCTCTCCAGGCCAGCGCCCCTGCTTTCGGACCGACGCT
CACCACTGCATCGCCCCTGATGCCGGCCGCGGCGCCCAACAGCTCGGCCGCCTTGGGCCACTTTCACGCGGCCTT
CTACCCGGCCAACAACTACGCGGCCAATGCGGCCACGGCCAGCTTCGGCGTGCCCATGCTCACGGCCGGCATGCA
GCAGATGGGCATCAGCGGCGTCAACGGCGGCACCGTCTACTCGGCGCAGAACTATACGGGCTTCGGCTCGATGCC
CTACAGCCAGGGCGCGCAGTCCCGCGACAGCCAGGCACGCGTGATGCAGACGCGTCGCCAGCTGGACAGTGAAGG
TTCGTCGAGCATCGGCTCGGGCGAAGCAGGACTCGTGCTGACCGCATCGCCGGCAGCAATGTCGCGCTACAACAA
CATGCCGCTCGAATCTTTCCGAGGCCAGATCTACGAGCTCTGCAAGGACCAGCACGGATGCCGCTACCTGCAGAA
GAAGCTCGAGGAGCGAGAGGCCGATCAGGTCAAGGTGATCTTGCAGGAGACGAAGCAGCACGTGACGGAGCTCAT
GATGGACCCGTTTGGCAACTATCTGTGCCAGAAGCTCCTCGAGTTCTGCAACGACGACGAGCGGACGGTCCTGAT
CCAGAACGCGTCCCAGGACATGGTGCGCATCGCCCTCAACCAGCACGGCACGCGGGCTCTGCAGAAGATGATCGA
GTTCGTCGGCACGGCTCAGCAGGTGCGGCTCATCATCGAGGCTCTCCGGTTCCGGGTCGTGGAGCTCATCCAGGA
CCTCAACGGCAACCATGTGATTCAGAAGTGCCTGAACAAGCTGGGGGCCAGCGATGCCCAGTTCATCTTTGACGC
CGTGGGCAGCAACTGCGTCGATGTCGGCACCCATCGCCACGGCTGCTGTGTTCTCCAGCGCTGCATCGACCACGC
CTCGGGTCACCAGAAGGCCTGGCTTGTTGAGCGCATCACGGACCACGCGCGTGTGCTCGTGCAGGATCCCTTTGG
CAACTACGTCGTTCAGTACATCATCGACCTCAACGAGCCAGGCTTCACCGATCCCGTCGTCCGCTCCTTCAAGGG
CTGTATCGGTTCGCTGTCGCGTCACAAGTTCAGCTCCAACGTGGTGGAGAAGTGCCTGCGCTGCGCGGGTCCCGA
GTCCAAGGACATGATTGTCGACGAGCTGCTCGCGCCTCAGGAGATTGAGCGTCACCTTCGCGACTCGTTCGGCAA
CTACGTCATCCAGACGGCCGTCGAGTTCGCGACACCTCACCAAAAGTACCGCCTGGTCGAGGCCATCCGCCCCCT
GCTGCCCCAGATCCGCAACACGCCTTATGGCCGTCGAATCCAGGCCAAGATCGCCCAGTACGACAACCGCGGAAT
CGCAGCCTCAAGCGGCCAGGCGACTCCCGCAGACAACACGCAGGGCCAAATCTCCATCCGCACCGCCCACACGCG
AGCCACCAGCAACGGCCGCCCCGTCTATGCCTTTCAGCCCACTCAGTTTGCCTACTCGCCCGCTCACCCCGTCAA
CGACGCTGCCGAGGGCGAACCCCAGTGGCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail