Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06565
Gene name
Locationscaffold_08:446765..459174
Strand+
Gene length (bp)12409
Transcript length (bp)12039
Coding sequence length (bp)12039
Protein length (aa) 4013

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06025 DUF913 Domain of Unknown Function (DUF913) 2.1E-141 569 1002
PF06012 DUF908 Domain of Unknown Function (DUF908) 1.7E-130 119 502
PF00632 HECT HECT-domain (ubiquitin-transferase) 1.3E-89 3707 4011
PF14377 UBM Ubiquitin binding region 2.6E-08 2922 2953
PF14377 UBM Ubiquitin binding region 7.4E-07 2961 2994
PF14377 UBM Ubiquitin binding region 1.5E-06 3011 3043

GO

GO Term Description Terminal node
GO:0004842 ubiquitin-protein transferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6399 0.5185 0.1451 0.1244 0.1154 0.0239 0.1632 0.2293 0.1841 0.0139

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup790
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2080
Ophiocordyceps australis 1348a (Ghana) OphauG2|2081
Ophiocordyceps australis map64 (Brazil) OphauB2|7487
Ophiocordyceps camponoti-floridani Ophcf2|06565 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3633
Ophiocordyceps kimflemingae Ophio5|819
Ophiocordyceps subramaniannii Hirsu2|3177
Ophiocordyceps subramaniannii Hirsu2|3178

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06565
MGKIIKTMQQRHRETLSPWLRGYIHSASTLALPLLPSRLATFPSRWPFGRGDLYHWIPLLNRFDSILDQFCKIYR
LHEGPQSCDFGCDLLLNTNRESAFAKENSWDEQELQNHGFSAQGDRELVEAVLRFTRMLLEHCGNRSIYASSAHL
NDLLNSSSLSVVIATLEVGSELAQRYQASVKRIGSSSRQISAALLANHYNIDLERVQQIALPFSKTPIIGLCDFT
SSTTPASAKGKEKAQTSTGRATTSIHANDLVAIATADDKHWTDWTDVRVIYYPQDSPTSNEAVTDAARSTQPSTP
TPLRRSSTMGNQQHTPKPRNTVNDDASSPITPRTPAVADEHNSLGQKSFEVPRSAVLTTPIYDLVQRCPDDMPSA
AKYDLFQRLRAAKALTGTIEERRQILAARLLAITNLAYIHIESTFVDKVLRQDIDETRRYQLVYQLAELIHPSAD
GKTDVPMWLQSIALALLEAISGFHARCQDVLSALNANVNHGILLYVIRKAVAGMAEDGASDADEQVTVADEWRNN
LFSLTLHLSMNTRVGSEMASAGLVDILVEILSLRSQISQRHHAMVLAFLDGLIWTYQTAFTAFINASGLGTVARL
LVDTVAEARKSLGSSKGIKADQQSSAVDYEVPYYQQQTLKWLLKFIHHVMSNSYTYNGNTDRLVRNLAEKSDLLR
SLREIMEDKKSFGSVVWTNSVTILSDFINNDPTSFAAISESGMIRTYLEAITGRPIADNHGDQKPKDNEHRDRDD
DESPDSPALASIVENDDRPHPPPVELLRQGRTQPLAQGILASGEAINVVPQVLNSISLNNTGMKLVIASRAFDSY
LEIFESPAHVKCMDTDGDLAHNVGSSFDELARHHPPLRTSISNAVIDMVARVRFLGIEKARTCGWGAKLFLSGAN
GEILSVNELGKLEDASKLSPQAREDDADVEMSDAVPQDEAKAGRRDDENDTGTSAESITPYIHALATFLTSYLSN
PLLKTNFIKKGGIELLLDICESPSLPATFGDSAASRSLNQVVSQLVEHSPIRALPSVLRRAQAAIDVLKPLADKT
GTIPPYFAPFLVPDLGLVQNGSDAPPTVLEGNLLVKALLNAQTFMKIVSDCFLTSRNNVLTFYPVNVYDYYLGLI
KSVGPLLRGVLVEEAAQLSVIPQHWSLRRHPPTAESGARDGDVDTDDTSLPEALNSATGWEAARDNDGASATRPT
QQEQASPRFQNYETLRVLLHPMIPTSFPLFQSLGKSLLPRRNDQNHPEPYTRSRHLEIAKALADSVLSHLAPSVA
TPEPSSKDFHYWIIMLHTIHEMLIDHPTSRQNDRSNMHIIMPVLLAFKERGGLDVLNSMLRVFTSAIQQGADGAS
DETSKSKVAAFGLKKVLDLYYYLVDGKHLSETANFFNLQPRHPDRPSPTVVCQQIVVQFRTAVLSAVMELFNGTF
LHKLPGATAKRLLDILKVIAGADHELQNSSSQHTSFNLFCHKDARFDWQPLRGVVNELLGTGFDEGLVHEAAYRA
NGNSGFATEYCQAHKDGLAGLRNPIPPEDADLSALTEPDTPVNNNPETSTNEREASNGSAVSDADRMSLDALPDL
TAEGLRDMIERPNQVEEAQQTGSGPAPATPTVAPADDASRDDGALILATKEKLDSLRANLRLDLVDSCLDVLRAH
PDTATDVHELIVVMALRRQNFEAYTDVGSTLIFALTSIAHDDEEEKKYTGKFIAAYAHLLALLVQDAHFLEANME
NLREKVDEYVSLLKLPMSSSSEDLPPWIPFVLLVLELFLCHDERLVAAQWKGPKSLEETCSAPVIQAGTSLIGDP
DRTKILDSLLELLPRIGKEEMLATAALRVLVILTRRRQAAKLVGEKRNLQRLFLMAKQLSGSGSERLKQTRLTAY
IITILRHVIEDDEIVKQVMRAEIQADFPNIQRNQRGPVDVSTYLRAMAPVALRNTDLFVEVTNELVQFTRWQPPS
AESSRSQGLALKSASKEGSETVDPPVESSPTQDIKPSTETADKDMMDAPKAPQHDSKRPIVENPDGVIHFLLCEL
VNYREVDDKEPVTLGKEGRADGESSTPGRDSGVKDKPASEERDKKQTKPVFKAVEHPIFVYRCFLLSCLAELLQS
YVRTKVEFINFKRSAPPATSQTPVKPRSSILNYLIYDLLCQGNLTGTTDSIASKKKAATSSLTQRVLVALVAKTS
ERPVERNRDKFAYDDEPDLLFVRKFVLDTILKAYEKAPLADEPLETRYTRMQCLAELMNQMIGEKEKDQNSGSRA
ADNVQNRSQAQLRRLMYEKGYVEKLTSSIAEVSLNYPGVKRAIKYILRVLRALTGTAKELSLSPLASSLPLDAAA
ADNSEEEFASTSSLSDVDDDREETPDLYRNSALGMLEPRADDDESGEEDEGDEDMYGDEYDDEEMDYGDDDTSED
GEDNISEDDDELNGMGEIEGLHGEPGVVEVIMDEDDDDTGDDEDDEEMDSADMEDLEDRVEIVDEEGNPLDEDGE
SAWESESDVEEVEDQEAEDLDYEAERQDEMEAHIHDMGPGGLLDNMARAIMGEDDGYEPELDVDNEHFIDDAHDD
GEEDEEEDDLEDDGYIYDEDYPLDEQPPPMPAGLGWDSFDPDDAQIRLMLLEAGQRRSVLAARMDNRSPFPPRFM
AGSNREHIDFRTFLSRGHRSTGGQASADDGVNPLLRPHQAPSEAAPRPGHNHSVGLRLPEGVFGGRNGIDGPMDL
LGELMEFLPMMGRSAAGQAFHFHITGPNGPRETREVSATRWPRNEQRREISAQEPHQAVSFTPESTLERYQEEAR
MMFRDVTIEASKLHTIIFAKLTPAAMELERRLKARDAEAQKRADEERKKREEEDRKAREAKAAEEKAAKEQKEAE
EREAAERAAAAMAAAAAATEAAANEAHDDGSGAMEGVEAADASGTSRAGGNAAPDPGSQRRVMTTIRGEEVDVTE
LGIDPDYLAALPEEFREEVIAQTVSERRSQAREEAATGESTEVFQEFLDALPEELRLEIAQQERQDERRREREEA
RRQAAHAGGSASVGAEMDPASILLTFPPELREQALIDQGEDLMDQLPPEMAAQARALAQQHAPLPQHRGIRSIVA
QGRSPPGAGRAEARNTAGNQGENRVQRRTVVQMLDKSGIATLLRLMFIAQQGSIRNYLFSVFADVCENRQNRLEV
VSSILQILQEGSVDMNAVERSFGQLSLKARKHKEKEVEQKTPQNLKRTLTGPAATSSTAQTNSETSPLLIVQQCL
DLLVDLSSRSHHIPWLFLTEHEIVGTTLKRALSRKGKVKDSRAHKYAINSLLTLLDRDLVTESSIVMTHLADLLN
RVTLPLQNLERRRREMAEEAKASKPAAAADEPGTGEAGEASAGQPSDQVEGETTVKDETEEKKAAAAATQKRSRQ
TQPPVIPPQNLTLVVRIFVARECNSKTFQNTISTIKNLSVIPGAKEAFGQELVRQARLLSENIVSDLDDLLPHID
QATTGTEIQGVALAKFSPGASEQNKLLRVLTALDHLFDAKKKAKDVEDAATKDREKQYLVTSLYHNSTFLAMWDK
LSACLRAIRQRENMLNVATILLPLIESLMVVCKNTTNDDQAASQTAMRDMVLSSPPPESRTASLFYSFTEDHRRI
LNELVRHNPKLMSGTFALLVKNPKVLDFDNKRNYFNRSVHSRNGQTNGRPSYPTLQLAVRRDHVFHDSFKSLYFK
SGDEMKFGKLNIRFHGEEGVDAGGVTREWFQVLARQMFDPNYALFIPVSSDRTTFHPNKLSGINDEHLMFFKFIG
RVIGKALYEGRLLDCFFSRAVYKRILGKSVSVKDMESFDPDYYKSLCWMLDNEITDIITETFSVENDEFGVTTVV
DLVPNGREISVSEENKHDYVRLVVEHKLLASVKDQMEHFLKGFHEIIPAKLISIFNEQELELLISGLPDIDIDDW
KSNTEYQNYTPSSQQIQWFWRAVRSFDKEERAKLLQFVTGTSKVPLNGFKELEGMNGVNRFNIHRDYGNKDRLPS
SHTCFNQLDIPEYDTYDMLRSQLHKAITQGSEYFGFA*
Coding >Ophcf2|06565
ATGGGCAAAATCATCAAAACTATGCAGCAGAGGCATAGGGAGACCTTGTCTCCTTGGCTTCGAGGCTACATACAC
TCTGCCTCGACGCTCGCGCTGCCTCTGCTACCGTCGCGTCTCGCCACTTTCCCCTCGAGATGGCCCTTCGGCCGT
GGTGATCTCTACCACTGGATCCCCCTGTTGAACCGCTTTGACAGTATTCTCGACCAGTTCTGCAAAATCTACCGT
CTGCACGAGGGCCCTCAATCCTGTGACTTCGGCTGCGACCTACTTCTGAATACAAACAGAGAGTCGGCCTTTGCC
AAGGAGAATAGTTGGGATGAACAGGAGCTCCAAAACCATGGCTTCTCCGCTCAAGGCGACCGCGAGCTCGTCGAG
GCTGTTCTTCGCTTCACCCGCATGTTACTCGAGCACTGCGGCAACCGAAGTATCTACGCCAGCAGCGCTCATCTC
AACGACCTTCTCAACAGCTCGTCGCTGTCCGTCGTCATCGCCACCCTAGAAGTAGGTTCCGAGTTGGCCCAGCGC
TATCAGGCCTCTGTCAAGCGCATCGGCAGCTCGTCTCGGCAAATTAGTGCCGCCCTGCTGGCCAACCACTACAAT
ATCGACCTCGAGCGCGTCCAGCAGATTGCCTTGCCCTTTTCCAAGACCCCAATCATCGGCCTCTGCGACTTCACG
TCGTCGACCACCCCGGCCTCGGCCAAGGGTAAGGAAAAGGCACAGACTTCGACTGGACGGGCCACGACATCCATT
CACGCAAACGACCTCGTTGCTATCGCGACCGCAGACGATAAGCACTGGACGGACTGGACGGATGTCAGGGTCATC
TATTACCCGCAAGACTCCCCGACCAGCAATGAGGCGGTCACCGATGCCGCCCGTTCGACCCAGCCTTCGACGCCG
ACACCCCTTCGCCGGAGCTCGACCATGGGCAACCAGCAGCATACCCCAAAGCCACGCAACACTGTTAATGATGAC
GCTTCTTCGCCCATCACACCCCGCACTCCCGCCGTCGCCGACGAGCATAATTCTCTGGGCCAAAAGTCGTTCGAG
GTTCCAAGGTCTGCGGTCTTGACGACGCCTATCTATGACCTCGTCCAGCGTTGCCCGGATGACATGCCTTCGGCG
GCCAAGTACGATCTTTTCCAGAGACTTCGTGCCGCCAAGGCCCTCACTGGCACGATCGAGGAGCGGCGTCAGATT
CTGGCCGCTCGGCTGCTTGCAATAACCAATTTGGCGTACATTCACATCGAGTCTACTTTCGTGGACAAAGTCTTG
CGCCAAGATATTGATGAGACGCGGAGATATCAGCTCGTCTATCAGTTGGCAGAGCTCATTCATCCGTCGGCGGAC
GGCAAGACTGACGTGCCCATGTGGTTGCAATCGATCGCCTTGGCTTTGCTAGAGGCTATTTCGGGATTCCACGCC
AGGTGTCAAGATGTCCTGTCCGCCCTCAACGCGAATGTGAACCATGGCATCTTGCTCTACGTCATACGAAAAGCC
GTGGCGGGCATGGCGGAAGATGGCGCTTCTGACGCCGATGAGCAAGTTACAGTCGCGGACGAATGGAGGAACAAC
CTCTTCTCCCTGACGCTGCACTTGTCTATGAACACGCGAGTTGGGAGTGAGATGGCGTCTGCTGGGCTAGTGGAC
ATTCTGGTTGAAATCCTTAGTCTTCGTTCCCAGATCTCCCAGCGCCATCATGCCATGGTTTTGGCTTTTCTTGAC
GGGCTGATTTGGACCTATCAGACTGCCTTTACGGCTTTCATCAACGCCAGCGGCTTGGGTACGGTGGCGAGACTG
CTCGTGGACACCGTCGCCGAGGCTCGCAAGTCGCTCGGCTCTTCCAAGGGCATCAAGGCGGATCAGCAGTCTAGT
GCTGTCGACTACGAAGTCCCGTACTATCAGCAACAGACTCTAAAATGGCTCCTGAAGTTCATTCACCACGTCATG
TCCAATTCTTACACGTACAACGGGAACACGGACCGGCTCGTCCGCAATCTTGCAGAGAAGTCGGATCTGTTGCGC
AGCCTGCGGGAAATTATGGAAGACAAGAAGAGCTTCGGTTCGGTGGTCTGGACGAACTCGGTTACGATCCTCAGC
GACTTCATCAACAACGACCCGACTAGCTTTGCAGCCATTTCAGAATCCGGCATGATTAGGACCTATCTCGAGGCC
ATCACGGGCCGGCCCATTGCAGATAACCACGGCGACCAGAAGCCCAAGGATAACGAGCATAGGGACAGGGACGAT
GATGAATCCCCAGACAGCCCGGCCCTCGCCTCCATCGTCGAAAACGACGACCGTCCTCACCCACCCCCGGTGGAG
TTGCTACGGCAGGGTCGAACTCAGCCGCTGGCCCAGGGGATCCTGGCCTCTGGCGAGGCCATCAACGTCGTTCCC
CAGGTGCTAAACTCCATATCGCTCAACAACACCGGCATGAAGCTTGTGATTGCCTCGCGAGCCTTTGACAGCTAT
CTGGAGATATTCGAGAGCCCTGCTCACGTCAAGTGCATGGACACGGATGGCGACCTCGCTCACAACGTCGGCAGC
AGCTTCGATGAGCTCGCTCGTCATCATCCTCCTTTGCGGACCTCCATCTCAAACGCCGTCATTGACATGGTTGCG
AGAGTGCGCTTCCTTGGCATCGAAAAGGCACGCACGTGCGGTTGGGGCGCGAAGCTGTTTCTCAGCGGCGCCAAC
GGCGAGATCCTGTCTGTCAATGAGCTCGGCAAGCTCGAGGACGCGAGCAAGTTGTCGCCTCAAGCGCGGGAGGAC
GATGCCGATGTCGAAATGTCCGACGCGGTGCCGCAGGACGAAGCAAAAGCAGGTCGACGCGATGACGAGAACGAT
ACGGGCACGTCTGCCGAGTCCATCACGCCCTACATCCATGCTCTGGCCACCTTCCTCACGTCGTATCTGTCCAAC
CCTCTGCTGAAGACCAACTTCATCAAGAAGGGGGGCATCGAGCTGCTCCTCGACATTTGCGAGTCGCCCAGCCTG
CCGGCCACTTTCGGCGACTCCGCTGCATCTCGATCCTTGAACCAGGTGGTATCTCAGCTGGTCGAGCATTCGCCC
ATCCGCGCCTTGCCCTCGGTGCTGCGCCGCGCTCAGGCCGCCATTGACGTGCTCAAGCCGCTCGCCGACAAGACG
GGGACGATTCCTCCTTACTTTGCGCCCTTCCTCGTGCCCGATCTGGGCCTCGTCCAGAACGGCTCCGATGCTCCG
CCCACCGTCTTGGAGGGGAACTTGCTGGTCAAGGCACTTTTGAATGCGCAGACCTTTATGAAGATTGTGTCTGAC
TGCTTCTTGACCTCGAGGAACAACGTCTTGACCTTTTATCCGGTCAATGTCTATGACTACTACCTCGGCCTGATA
AAGTCGGTCGGGCCCCTCTTGCGTGGTGTTCTGGTCGAGGAGGCAGCGCAGTTGTCTGTCATCCCCCAGCATTGG
TCCTTGAGACGTCACCCGCCCACGGCCGAAAGCGGCGCCCGGGACGGCGACGTGGACACCGACGACACATCTCTG
CCGGAGGCGCTGAATAGTGCGACCGGATGGGAAGCGGCTCGAGACAACGATGGCGCTTCGGCGACGCGACCCACG
CAACAGGAGCAAGCCAGCCCGCGTTTCCAGAACTACGAAACTCTACGCGTCTTGCTGCACCCAATGATTCCGACT
TCTTTCCCGCTGTTTCAATCCTTAGGGAAGTCGCTTCTGCCCCGTCGCAACGACCAGAACCATCCTGAGCCTTAT
ACGAGATCTCGTCACCTCGAGATTGCCAAAGCTCTGGCCGATTCTGTTCTCAGCCATCTGGCTCCATCCGTTGCC
ACGCCAGAACCGTCTTCCAAGGATTTCCACTACTGGATCATCATGCTCCACACCATTCATGAGATGCTCATCGAC
CATCCTACATCGAGGCAGAACGACCGCTCTAACATGCACATCATAATGCCTGTCCTACTAGCATTCAAGGAACGC
GGCGGCTTGGATGTGCTCAACTCTATGTTGAGGGTCTTCACCAGCGCCATCCAACAGGGTGCTGACGGCGCTTCC
GACGAGACGTCCAAGAGCAAGGTCGCTGCCTTTGGTCTGAAGAAGGTGCTCGACCTGTATTACTACCTCGTCGAC
GGGAAGCACCTATCGGAGACTGCAAACTTTTTCAATCTGCAGCCCCGTCACCCCGATAGGCCGAGCCCGACCGTT
GTCTGTCAGCAGATCGTTGTGCAGTTCCGTACGGCCGTGTTGTCGGCCGTCATGGAGCTCTTCAACGGGACCTTT
CTCCACAAACTTCCGGGTGCCACAGCCAAGCGGCTGCTTGACATCCTCAAAGTAATCGCCGGTGCTGATCATGAG
CTTCAAAACTCCAGCTCGCAACACACTTCTTTCAACCTCTTCTGCCACAAGGATGCTCGATTCGACTGGCAGCCT
CTCCGCGGCGTCGTCAACGAGCTCCTCGGCACGGGCTTTGACGAGGGCTTGGTGCACGAGGCGGCGTACAGAGCC
AATGGCAACAGCGGTTTCGCCACTGAATATTGCCAGGCCCACAAGGATGGCCTGGCCGGCCTGCGGAACCCGATT
CCGCCAGAAGACGCGGACCTCTCTGCGTTGACAGAGCCCGACACACCTGTCAATAACAATCCGGAGACTTCGACA
AACGAAAGAGAGGCTTCCAATGGGTCAGCCGTGTCCGACGCCGATCGCATGTCGCTGGATGCGCTGCCTGATCTG
ACTGCCGAGGGGCTTCGGGACATGATTGAGCGCCCCAACCAGGTGGAAGAGGCTCAGCAGACAGGGTCTGGACCC
GCGCCCGCTACACCAACAGTTGCGCCTGCAGACGATGCCAGTCGAGATGATGGAGCTCTAATCCTAGCCACGAAG
GAGAAGCTGGATAGTCTCAGGGCAAATCTCAGGCTCGACCTGGTTGACTCATGTCTGGACGTTCTTCGCGCCCAC
CCGGACACGGCGACGGACGTCCATGAGCTCATCGTGGTAATGGCTCTCAGACGGCAGAACTTCGAAGCGTACACC
GACGTTGGTTCCACGCTGATCTTCGCGCTGACTTCGATCGCCCACGACGACGAGGAAGAGAAGAAGTACACTGGA
AAATTCATCGCCGCCTATGCTCATCTCTTGGCACTCCTTGTTCAGGACGCTCATTTCCTCGAGGCAAACATGGAG
AATTTACGGGAAAAGGTCGATGAGTACGTGAGCCTCCTGAAGCTGCCAATGTCTTCTTCGTCCGAGGACTTGCCG
CCCTGGATCCCTTTCGTCCTCTTGGTTCTCGAGCTCTTCCTTTGCCACGACGAGCGGCTTGTCGCCGCACAGTGG
AAGGGCCCCAAATCGCTTGAGGAGACATGTTCGGCTCCGGTCATCCAGGCGGGGACGTCGTTGATCGGCGACCCT
GACCGCACCAAAATACTGGACTCGTTGCTTGAGTTGCTTCCCCGAATCGGCAAGGAAGAGATGCTGGCAACTGCG
GCTCTGAGGGTCCTCGTCATCCTGACTCGACGCCGCCAGGCGGCGAAACTTGTCGGCGAGAAGCGAAACTTGCAG
AGGCTGTTTCTTATGGCCAAACAGCTGTCTGGGTCTGGCTCTGAGCGCCTCAAACAGACGAGATTGACCGCGTAC
ATCATCACCATTCTGCGCCACGTCATTGAGGACGACGAGATTGTCAAGCAGGTCATGCGTGCCGAGATCCAGGCC
GACTTTCCCAACATACAGCGGAATCAGCGCGGGCCTGTTGATGTGTCGACGTATCTGCGGGCCATGGCCCCGGTT
GCTCTTCGAAACACAGATTTGTTCGTCGAGGTCACGAACGAGCTGGTGCAGTTTACCAGGTGGCAGCCCCCGTCT
GCTGAATCCAGTCGTTCGCAGGGTCTGGCCCTCAAGAGCGCTTCTAAGGAAGGATCCGAGACTGTCGATCCACCC
GTCGAAAGTTCCCCGACCCAGGATATCAAGCCGTCGACCGAGACTGCGGACAAGGACATGATGGATGCGCCCAAG
GCACCCCAGCACGACAGCAAGCGACCGATCGTCGAGAACCCGGACGGCGTCATTCATTTTCTTCTCTGCGAGCTC
GTCAATTACCGCGAGGTGGACGACAAGGAGCCGGTCACTCTCGGCAAAGAGGGCAGGGCAGATGGTGAGTCGTCT
ACGCCTGGTCGAGACTCCGGGGTCAAGGACAAGCCAGCCTCGGAAGAGAGAGACAAGAAGCAGACGAAACCGGTT
TTCAAGGCCGTGGAGCATCCGATATTCGTGTATCGATGCTTCCTCCTAAGTTGCCTCGCCGAACTCCTGCAGAGC
TACGTCAGGACCAAAGTCGAGTTCATCAACTTTAAGCGCAGCGCACCTCCCGCTACATCCCAAACGCCGGTCAAA
CCCAGGTCCAGCATCCTCAACTATCTGATCTACGACCTGCTGTGCCAGGGGAACCTCACTGGGACGACGGACAGC
ATCGCATCCAAGAAGAAAGCCGCGACGTCGTCGTTGACGCAGCGGGTTCTTGTAGCACTCGTCGCCAAAACCAGC
GAGCGACCAGTGGAGCGCAATCGCGACAAGTTTGCGTACGACGACGAGCCCGATCTTCTCTTCGTCCGCAAGTTC
GTCCTCGACACGATTCTCAAGGCCTACGAAAAGGCGCCGCTTGCGGATGAGCCTCTTGAGACGAGATACACTCGG
ATGCAGTGCTTGGCGGAGCTCATGAATCAAATGATTGGCGAGAAGGAAAAGGATCAAAACTCCGGATCTCGAGCG
GCCGACAACGTACAGAACCGTTCTCAAGCGCAGCTGCGTCGGTTGATGTACGAGAAGGGATACGTGGAGAAGCTG
ACGTCGTCAATTGCCGAAGTCAGCCTAAACTATCCCGGCGTCAAGCGTGCAATCAAGTACATCCTTCGAGTTCTT
CGCGCCTTGACCGGGACGGCAAAGGAACTCAGTCTCTCGCCTCTGGCGAGCTCATTGCCATTGGACGCGGCTGCT
GCGGACAACAGCGAAGAGGAGTTTGCCTCAACGTCGTCGCTGTCAGATGTCGATGACGACCGAGAGGAGACTCCG
GATCTCTATCGCAACTCTGCCCTAGGCATGCTCGAGCCTCGCGCCGACGATGACGAGTCGGGCGAAGAGGACGAG
GGCGACGAGGACATGTACGGCGACGAGTACGACGACGAGGAGATGGACTACGGAGACGACGACACCTCGGAAGAC
GGCGAGGACAATATCAGCGAGGACGACGATGAGCTCAACGGAATGGGTGAGATTGAAGGCCTTCATGGCGAGCCG
GGCGTCGTCGAGGTCATCATGGACGAGGACGACGATGACACGGGCGACGATGAGGACGACGAGGAGATGGACTCT
GCTGACATGGAGGACCTGGAAGACCGCGTCGAGATTGTGGATGAAGAAGGAAATCCTCTCGATGAAGATGGAGAG
TCGGCTTGGGAAAGCGAGAGCGACGTCGAAGAAGTGGAAGACCAAGAGGCCGAGGACCTCGACTACGAAGCGGAA
AGGCAAGATGAGATGGAAGCTCATATCCACGACATGGGACCCGGTGGCTTGCTCGATAACATGGCTAGAGCCATC
ATGGGAGAAGACGACGGATACGAGCCGGAGCTGGATGTCGACAATGAGCATTTCATCGACGACGCTCATGATGAC
GGAGAAGAAGACGAGGAGGAGGACGACTTGGAAGACGATGGATACATCTACGACGAGGACTATCCTCTTGATGAA
CAACCGCCGCCGATGCCTGCCGGTCTGGGCTGGGACAGCTTCGATCCAGACGATGCACAGATCAGGCTCATGCTA
CTCGAAGCTGGTCAGAGGCGGTCCGTTCTTGCTGCTAGGATGGACAACCGCAGCCCGTTTCCACCCCGGTTCATG
GCCGGATCGAATCGAGAGCATATTGACTTCCGTACCTTTCTCTCGCGAGGGCACCGCTCGACGGGGGGTCAAGCG
AGCGCAGACGACGGCGTGAACCCTCTGCTTCGACCGCACCAGGCGCCGTCTGAAGCCGCGCCCCGTCCTGGACAC
AATCACTCGGTAGGGCTCAGGCTTCCCGAAGGCGTTTTTGGGGGCAGAAACGGGATCGACGGCCCGATGGATCTC
CTGGGCGAACTCATGGAGTTTCTCCCCATGATGGGTCGCAGCGCCGCCGGTCAAGCTTTCCATTTCCACATCACC
GGTCCCAACGGCCCGCGCGAGACGCGTGAGGTGAGCGCAACGCGATGGCCCAGGAACGAACAGCGTCGAGAAATC
TCGGCACAGGAACCCCATCAGGCGGTATCCTTCACGCCCGAGTCCACCCTCGAGCGCTATCAGGAGGAGGCCAGG
ATGATGTTCCGGGACGTTACGATTGAGGCCTCTAAACTGCACACCATCATCTTCGCGAAGCTCACGCCTGCGGCC
ATGGAGCTGGAGAGACGGTTGAAGGCGCGAGATGCCGAGGCGCAGAAGCGCGCGGACGAGGAGCGCAAGAAGCGC
GAGGAAGAAGACCGCAAGGCACGGGAGGCAAAAGCTGCCGAGGAGAAGGCGGCCAAGGAGCAAAAGGAAGCCGAG
GAGCGAGAGGCTGCGGAACGAGCGGCAGCAGCCATGGCCGCGGCAGCCGCTGCCACCGAAGCCGCTGCCAACGAG
GCCCACGACGATGGGAGCGGCGCCATGGAGGGCGTCGAGGCAGCCGATGCTTCAGGAACGAGCCGGGCTGGCGGC
AACGCGGCCCCGGACCCCGGCAGTCAGCGCAGAGTCATGACGACAATTCGAGGCGAGGAAGTGGACGTGACGGAG
CTCGGGATAGACCCGGACTACCTTGCGGCGCTGCCTGAGGAGTTCAGAGAGGAGGTGATTGCGCAGACGGTCAGC
GAGAGGCGATCTCAGGCTCGTGAGGAGGCAGCCACGGGCGAGTCGACGGAAGTTTTCCAAGAGTTCCTCGACGCC
CTGCCGGAGGAGCTTCGTCTGGAGATTGCGCAGCAGGAGAGGCAGGACGAGCGCCGTCGGGAACGCGAAGAGGCC
CGTCGCCAGGCTGCCCACGCTGGAGGTTCGGCGTCAGTGGGAGCCGAGATGGATCCCGCCAGCATTCTGCTCACC
TTCCCGCCCGAGCTGCGGGAGCAGGCCCTGATCGACCAGGGAGAGGATCTCATGGATCAGCTTCCTCCGGAGATG
GCGGCCCAGGCCCGGGCTCTGGCACAACAGCACGCGCCTCTTCCGCAGCATCGTGGCATCCGAAGCATCGTGGCT
CAAGGCAGATCGCCCCCCGGGGCTGGCAGGGCCGAAGCGCGCAACACGGCGGGAAATCAGGGCGAGAACAGAGTC
CAGCGGCGAACCGTGGTTCAGATGCTCGACAAGTCTGGAATCGCAACGCTGCTGCGGTTGATGTTCATTGCCCAG
CAAGGATCGATACGGAATTATCTTTTCAGCGTCTTTGCCGACGTCTGCGAGAACCGGCAGAACCGGCTCGAGGTC
GTCAGCAGTATCCTGCAGATCCTCCAAGAGGGTAGTGTCGATATGAATGCCGTCGAACGAAGCTTCGGCCAGCTC
TCGCTGAAGGCGAGAAAGCACAAGGAGAAGGAGGTCGAGCAGAAGACTCCGCAGAATCTCAAGAGGACTCTGACG
GGCCCAGCCGCGACCAGCAGCACGGCTCAGACCAACTCGGAAACGTCGCCCCTGCTCATAGTCCAGCAATGTTTG
GACCTCCTCGTGGACCTCAGCTCGAGGAGCCATCACATCCCCTGGCTCTTCTTGACCGAGCACGAGATTGTCGGA
ACGACGCTCAAGAGGGCTCTGAGCCGCAAGGGCAAGGTCAAAGACTCCAGGGCTCACAAGTACGCCATCAACTCG
CTGTTGACGTTGCTGGACCGCGACTTGGTGACGGAGAGCTCCATCGTCATGACGCATCTCGCCGACCTGCTGAAT
CGCGTCACTCTGCCGCTCCAGAACCTCGAGCGCCGGCGCAGGGAGATGGCAGAGGAGGCCAAGGCCTCCAAGCCG
GCGGCTGCGGCCGACGAGCCAGGCACGGGCGAAGCTGGCGAGGCGAGCGCTGGGCAGCCGTCGGATCAGGTCGAG
GGCGAGACGACGGTCAAGGACGAGACGGAGGAGAAGAAGGCGGCGGCTGCGGCGACGCAGAAGCGATCCCGGCAG
ACTCAACCGCCCGTGATCCCGCCGCAGAACCTGACGCTGGTTGTGCGCATCTTTGTGGCCCGAGAGTGCAACTCG
AAGACGTTCCAGAACACCATCTCGACCATCAAGAACCTCTCGGTGATACCGGGTGCCAAGGAGGCTTTTGGACAG
GAGCTTGTCCGTCAGGCGCGGCTCCTGAGCGAGAACATCGTTTCGGATCTCGACGACCTCTTGCCTCACATCGAC
CAGGCCACGACGGGCACCGAGATTCAGGGCGTCGCCCTGGCCAAGTTCTCTCCCGGAGCGTCTGAGCAGAACAAG
CTCCTACGGGTCCTGACGGCTTTGGACCACCTGTTCGACGCCAAGAAGAAGGCCAAGGACGTGGAGGACGCGGCG
ACCAAGGACCGGGAGAAGCAGTATCTCGTCACGTCGCTCTACCACAACTCGACCTTCTTGGCCATGTGGGATAAG
CTGAGCGCCTGCCTCCGGGCGATCCGCCAGCGCGAGAACATGCTCAACGTGGCGACGATACTGTTGCCCCTGATC
GAGTCGCTCATGGTCGTCTGCAAGAACACGACCAACGACGATCAGGCGGCCAGCCAGACGGCCATGAGGGACATG
GTCTTATCCAGCCCGCCTCCCGAATCGCGGACGGCCAGCCTGTTCTATAGCTTCACCGAGGATCACCGACGCATC
CTCAACGAGCTCGTCCGACACAACCCCAAGCTCATGTCGGGCACGTTTGCCTTGCTCGTTAAGAACCCCAAGGTG
CTCGACTTCGACAATAAGCGCAACTACTTCAACCGCAGCGTCCATTCGCGGAACGGCCAGACTAACGGGCGGCCG
TCGTATCCGACGCTCCAGCTGGCGGTCCGGCGCGACCACGTCTTCCACGACTCTTTCAAGTCGCTATACTTCAAG
TCCGGCGATGAGATGAAGTTTGGCAAGCTCAATATTCGCTTCCACGGCGAAGAAGGCGTCGATGCCGGAGGCGTA
ACGCGCGAGTGGTTCCAGGTCTTGGCCCGTCAGATGTTCGACCCGAACTATGCGCTCTTCATCCCCGTCTCGTCG
GATCGGACGACGTTCCACCCGAACAAGCTGAGCGGCATCAACGACGAGCATCTCATGTTCTTCAAGTTCATCGGC
CGCGTCATCGGAAAGGCCCTTTACGAGGGCCGCCTGCTCGACTGCTTCTTCAGCCGGGCCGTCTACAAGCGCATC
CTCGGCAAGTCGGTGTCGGTCAAGGACATGGAGTCGTTCGATCCGGATTACTACAAGTCCCTGTGCTGGATGCTG
GACAACGAGATCACCGACATCATCACCGAGACGTTTTCCGTCGAGAACGACGAGTTCGGCGTGACGACCGTCGTG
GACCTCGTGCCCAACGGTCGAGAGATTTCCGTCTCGGAGGAGAACAAGCACGACTATGTGCGGCTCGTGGTCGAG
CATAAGCTCCTGGCCTCGGTCAAGGATCAGATGGAACACTTCCTCAAAGGTTTCCACGAGATCATCCCCGCCAAG
CTCATCTCCATCTTCAACGAGCAGGAGCTCGAGCTGCTGATTTCCGGCCTCCCGGACATTGACATTGACGACTGG
AAGAGCAACACGGAGTACCAGAACTACACTCCGTCGTCGCAGCAGATCCAGTGGTTCTGGAGGGCCGTGAGGTCG
TTTGACAAGGAGGAACGGGCCAAGCTGCTGCAGTTCGTCACCGGCACCAGCAAGGTTCCCCTCAACGGCTTCAAG
GAGCTCGAGGGCATGAACGGCGTCAACCGGTTCAACATCCATCGCGACTACGGCAACAAGGATCGTCTTCCGTCC
TCGCACACGTGCTTCAACCAGCTCGACATCCCCGAGTACGACACTTACGACATGCTGCGCTCGCAGCTGCACAAG
GCCATCACTCAGGGAAGCGAATACTTTGGTTTCGCCTGA
Transcript >Ophcf2|06565
ATGGGCAAAATCATCAAAACTATGCAGCAGAGGCATAGGGAGACCTTGTCTCCTTGGCTTCGAGGCTACATACAC
TCTGCCTCGACGCTCGCGCTGCCTCTGCTACCGTCGCGTCTCGCCACTTTCCCCTCGAGATGGCCCTTCGGCCGT
GGTGATCTCTACCACTGGATCCCCCTGTTGAACCGCTTTGACAGTATTCTCGACCAGTTCTGCAAAATCTACCGT
CTGCACGAGGGCCCTCAATCCTGTGACTTCGGCTGCGACCTACTTCTGAATACAAACAGAGAGTCGGCCTTTGCC
AAGGAGAATAGTTGGGATGAACAGGAGCTCCAAAACCATGGCTTCTCCGCTCAAGGCGACCGCGAGCTCGTCGAG
GCTGTTCTTCGCTTCACCCGCATGTTACTCGAGCACTGCGGCAACCGAAGTATCTACGCCAGCAGCGCTCATCTC
AACGACCTTCTCAACAGCTCGTCGCTGTCCGTCGTCATCGCCACCCTAGAAGTAGGTTCCGAGTTGGCCCAGCGC
TATCAGGCCTCTGTCAAGCGCATCGGCAGCTCGTCTCGGCAAATTAGTGCCGCCCTGCTGGCCAACCACTACAAT
ATCGACCTCGAGCGCGTCCAGCAGATTGCCTTGCCCTTTTCCAAGACCCCAATCATCGGCCTCTGCGACTTCACG
TCGTCGACCACCCCGGCCTCGGCCAAGGGTAAGGAAAAGGCACAGACTTCGACTGGACGGGCCACGACATCCATT
CACGCAAACGACCTCGTTGCTATCGCGACCGCAGACGATAAGCACTGGACGGACTGGACGGATGTCAGGGTCATC
TATTACCCGCAAGACTCCCCGACCAGCAATGAGGCGGTCACCGATGCCGCCCGTTCGACCCAGCCTTCGACGCCG
ACACCCCTTCGCCGGAGCTCGACCATGGGCAACCAGCAGCATACCCCAAAGCCACGCAACACTGTTAATGATGAC
GCTTCTTCGCCCATCACACCCCGCACTCCCGCCGTCGCCGACGAGCATAATTCTCTGGGCCAAAAGTCGTTCGAG
GTTCCAAGGTCTGCGGTCTTGACGACGCCTATCTATGACCTCGTCCAGCGTTGCCCGGATGACATGCCTTCGGCG
GCCAAGTACGATCTTTTCCAGAGACTTCGTGCCGCCAAGGCCCTCACTGGCACGATCGAGGAGCGGCGTCAGATT
CTGGCCGCTCGGCTGCTTGCAATAACCAATTTGGCGTACATTCACATCGAGTCTACTTTCGTGGACAAAGTCTTG
CGCCAAGATATTGATGAGACGCGGAGATATCAGCTCGTCTATCAGTTGGCAGAGCTCATTCATCCGTCGGCGGAC
GGCAAGACTGACGTGCCCATGTGGTTGCAATCGATCGCCTTGGCTTTGCTAGAGGCTATTTCGGGATTCCACGCC
AGGTGTCAAGATGTCCTGTCCGCCCTCAACGCGAATGTGAACCATGGCATCTTGCTCTACGTCATACGAAAAGCC
GTGGCGGGCATGGCGGAAGATGGCGCTTCTGACGCCGATGAGCAAGTTACAGTCGCGGACGAATGGAGGAACAAC
CTCTTCTCCCTGACGCTGCACTTGTCTATGAACACGCGAGTTGGGAGTGAGATGGCGTCTGCTGGGCTAGTGGAC
ATTCTGGTTGAAATCCTTAGTCTTCGTTCCCAGATCTCCCAGCGCCATCATGCCATGGTTTTGGCTTTTCTTGAC
GGGCTGATTTGGACCTATCAGACTGCCTTTACGGCTTTCATCAACGCCAGCGGCTTGGGTACGGTGGCGAGACTG
CTCGTGGACACCGTCGCCGAGGCTCGCAAGTCGCTCGGCTCTTCCAAGGGCATCAAGGCGGATCAGCAGTCTAGT
GCTGTCGACTACGAAGTCCCGTACTATCAGCAACAGACTCTAAAATGGCTCCTGAAGTTCATTCACCACGTCATG
TCCAATTCTTACACGTACAACGGGAACACGGACCGGCTCGTCCGCAATCTTGCAGAGAAGTCGGATCTGTTGCGC
AGCCTGCGGGAAATTATGGAAGACAAGAAGAGCTTCGGTTCGGTGGTCTGGACGAACTCGGTTACGATCCTCAGC
GACTTCATCAACAACGACCCGACTAGCTTTGCAGCCATTTCAGAATCCGGCATGATTAGGACCTATCTCGAGGCC
ATCACGGGCCGGCCCATTGCAGATAACCACGGCGACCAGAAGCCCAAGGATAACGAGCATAGGGACAGGGACGAT
GATGAATCCCCAGACAGCCCGGCCCTCGCCTCCATCGTCGAAAACGACGACCGTCCTCACCCACCCCCGGTGGAG
TTGCTACGGCAGGGTCGAACTCAGCCGCTGGCCCAGGGGATCCTGGCCTCTGGCGAGGCCATCAACGTCGTTCCC
CAGGTGCTAAACTCCATATCGCTCAACAACACCGGCATGAAGCTTGTGATTGCCTCGCGAGCCTTTGACAGCTAT
CTGGAGATATTCGAGAGCCCTGCTCACGTCAAGTGCATGGACACGGATGGCGACCTCGCTCACAACGTCGGCAGC
AGCTTCGATGAGCTCGCTCGTCATCATCCTCCTTTGCGGACCTCCATCTCAAACGCCGTCATTGACATGGTTGCG
AGAGTGCGCTTCCTTGGCATCGAAAAGGCACGCACGTGCGGTTGGGGCGCGAAGCTGTTTCTCAGCGGCGCCAAC
GGCGAGATCCTGTCTGTCAATGAGCTCGGCAAGCTCGAGGACGCGAGCAAGTTGTCGCCTCAAGCGCGGGAGGAC
GATGCCGATGTCGAAATGTCCGACGCGGTGCCGCAGGACGAAGCAAAAGCAGGTCGACGCGATGACGAGAACGAT
ACGGGCACGTCTGCCGAGTCCATCACGCCCTACATCCATGCTCTGGCCACCTTCCTCACGTCGTATCTGTCCAAC
CCTCTGCTGAAGACCAACTTCATCAAGAAGGGGGGCATCGAGCTGCTCCTCGACATTTGCGAGTCGCCCAGCCTG
CCGGCCACTTTCGGCGACTCCGCTGCATCTCGATCCTTGAACCAGGTGGTATCTCAGCTGGTCGAGCATTCGCCC
ATCCGCGCCTTGCCCTCGGTGCTGCGCCGCGCTCAGGCCGCCATTGACGTGCTCAAGCCGCTCGCCGACAAGACG
GGGACGATTCCTCCTTACTTTGCGCCCTTCCTCGTGCCCGATCTGGGCCTCGTCCAGAACGGCTCCGATGCTCCG
CCCACCGTCTTGGAGGGGAACTTGCTGGTCAAGGCACTTTTGAATGCGCAGACCTTTATGAAGATTGTGTCTGAC
TGCTTCTTGACCTCGAGGAACAACGTCTTGACCTTTTATCCGGTCAATGTCTATGACTACTACCTCGGCCTGATA
AAGTCGGTCGGGCCCCTCTTGCGTGGTGTTCTGGTCGAGGAGGCAGCGCAGTTGTCTGTCATCCCCCAGCATTGG
TCCTTGAGACGTCACCCGCCCACGGCCGAAAGCGGCGCCCGGGACGGCGACGTGGACACCGACGACACATCTCTG
CCGGAGGCGCTGAATAGTGCGACCGGATGGGAAGCGGCTCGAGACAACGATGGCGCTTCGGCGACGCGACCCACG
CAACAGGAGCAAGCCAGCCCGCGTTTCCAGAACTACGAAACTCTACGCGTCTTGCTGCACCCAATGATTCCGACT
TCTTTCCCGCTGTTTCAATCCTTAGGGAAGTCGCTTCTGCCCCGTCGCAACGACCAGAACCATCCTGAGCCTTAT
ACGAGATCTCGTCACCTCGAGATTGCCAAAGCTCTGGCCGATTCTGTTCTCAGCCATCTGGCTCCATCCGTTGCC
ACGCCAGAACCGTCTTCCAAGGATTTCCACTACTGGATCATCATGCTCCACACCATTCATGAGATGCTCATCGAC
CATCCTACATCGAGGCAGAACGACCGCTCTAACATGCACATCATAATGCCTGTCCTACTAGCATTCAAGGAACGC
GGCGGCTTGGATGTGCTCAACTCTATGTTGAGGGTCTTCACCAGCGCCATCCAACAGGGTGCTGACGGCGCTTCC
GACGAGACGTCCAAGAGCAAGGTCGCTGCCTTTGGTCTGAAGAAGGTGCTCGACCTGTATTACTACCTCGTCGAC
GGGAAGCACCTATCGGAGACTGCAAACTTTTTCAATCTGCAGCCCCGTCACCCCGATAGGCCGAGCCCGACCGTT
GTCTGTCAGCAGATCGTTGTGCAGTTCCGTACGGCCGTGTTGTCGGCCGTCATGGAGCTCTTCAACGGGACCTTT
CTCCACAAACTTCCGGGTGCCACAGCCAAGCGGCTGCTTGACATCCTCAAAGTAATCGCCGGTGCTGATCATGAG
CTTCAAAACTCCAGCTCGCAACACACTTCTTTCAACCTCTTCTGCCACAAGGATGCTCGATTCGACTGGCAGCCT
CTCCGCGGCGTCGTCAACGAGCTCCTCGGCACGGGCTTTGACGAGGGCTTGGTGCACGAGGCGGCGTACAGAGCC
AATGGCAACAGCGGTTTCGCCACTGAATATTGCCAGGCCCACAAGGATGGCCTGGCCGGCCTGCGGAACCCGATT
CCGCCAGAAGACGCGGACCTCTCTGCGTTGACAGAGCCCGACACACCTGTCAATAACAATCCGGAGACTTCGACA
AACGAAAGAGAGGCTTCCAATGGGTCAGCCGTGTCCGACGCCGATCGCATGTCGCTGGATGCGCTGCCTGATCTG
ACTGCCGAGGGGCTTCGGGACATGATTGAGCGCCCCAACCAGGTGGAAGAGGCTCAGCAGACAGGGTCTGGACCC
GCGCCCGCTACACCAACAGTTGCGCCTGCAGACGATGCCAGTCGAGATGATGGAGCTCTAATCCTAGCCACGAAG
GAGAAGCTGGATAGTCTCAGGGCAAATCTCAGGCTCGACCTGGTTGACTCATGTCTGGACGTTCTTCGCGCCCAC
CCGGACACGGCGACGGACGTCCATGAGCTCATCGTGGTAATGGCTCTCAGACGGCAGAACTTCGAAGCGTACACC
GACGTTGGTTCCACGCTGATCTTCGCGCTGACTTCGATCGCCCACGACGACGAGGAAGAGAAGAAGTACACTGGA
AAATTCATCGCCGCCTATGCTCATCTCTTGGCACTCCTTGTTCAGGACGCTCATTTCCTCGAGGCAAACATGGAG
AATTTACGGGAAAAGGTCGATGAGTACGTGAGCCTCCTGAAGCTGCCAATGTCTTCTTCGTCCGAGGACTTGCCG
CCCTGGATCCCTTTCGTCCTCTTGGTTCTCGAGCTCTTCCTTTGCCACGACGAGCGGCTTGTCGCCGCACAGTGG
AAGGGCCCCAAATCGCTTGAGGAGACATGTTCGGCTCCGGTCATCCAGGCGGGGACGTCGTTGATCGGCGACCCT
GACCGCACCAAAATACTGGACTCGTTGCTTGAGTTGCTTCCCCGAATCGGCAAGGAAGAGATGCTGGCAACTGCG
GCTCTGAGGGTCCTCGTCATCCTGACTCGACGCCGCCAGGCGGCGAAACTTGTCGGCGAGAAGCGAAACTTGCAG
AGGCTGTTTCTTATGGCCAAACAGCTGTCTGGGTCTGGCTCTGAGCGCCTCAAACAGACGAGATTGACCGCGTAC
ATCATCACCATTCTGCGCCACGTCATTGAGGACGACGAGATTGTCAAGCAGGTCATGCGTGCCGAGATCCAGGCC
GACTTTCCCAACATACAGCGGAATCAGCGCGGGCCTGTTGATGTGTCGACGTATCTGCGGGCCATGGCCCCGGTT
GCTCTTCGAAACACAGATTTGTTCGTCGAGGTCACGAACGAGCTGGTGCAGTTTACCAGGTGGCAGCCCCCGTCT
GCTGAATCCAGTCGTTCGCAGGGTCTGGCCCTCAAGAGCGCTTCTAAGGAAGGATCCGAGACTGTCGATCCACCC
GTCGAAAGTTCCCCGACCCAGGATATCAAGCCGTCGACCGAGACTGCGGACAAGGACATGATGGATGCGCCCAAG
GCACCCCAGCACGACAGCAAGCGACCGATCGTCGAGAACCCGGACGGCGTCATTCATTTTCTTCTCTGCGAGCTC
GTCAATTACCGCGAGGTGGACGACAAGGAGCCGGTCACTCTCGGCAAAGAGGGCAGGGCAGATGGTGAGTCGTCT
ACGCCTGGTCGAGACTCCGGGGTCAAGGACAAGCCAGCCTCGGAAGAGAGAGACAAGAAGCAGACGAAACCGGTT
TTCAAGGCCGTGGAGCATCCGATATTCGTGTATCGATGCTTCCTCCTAAGTTGCCTCGCCGAACTCCTGCAGAGC
TACGTCAGGACCAAAGTCGAGTTCATCAACTTTAAGCGCAGCGCACCTCCCGCTACATCCCAAACGCCGGTCAAA
CCCAGGTCCAGCATCCTCAACTATCTGATCTACGACCTGCTGTGCCAGGGGAACCTCACTGGGACGACGGACAGC
ATCGCATCCAAGAAGAAAGCCGCGACGTCGTCGTTGACGCAGCGGGTTCTTGTAGCACTCGTCGCCAAAACCAGC
GAGCGACCAGTGGAGCGCAATCGCGACAAGTTTGCGTACGACGACGAGCCCGATCTTCTCTTCGTCCGCAAGTTC
GTCCTCGACACGATTCTCAAGGCCTACGAAAAGGCGCCGCTTGCGGATGAGCCTCTTGAGACGAGATACACTCGG
ATGCAGTGCTTGGCGGAGCTCATGAATCAAATGATTGGCGAGAAGGAAAAGGATCAAAACTCCGGATCTCGAGCG
GCCGACAACGTACAGAACCGTTCTCAAGCGCAGCTGCGTCGGTTGATGTACGAGAAGGGATACGTGGAGAAGCTG
ACGTCGTCAATTGCCGAAGTCAGCCTAAACTATCCCGGCGTCAAGCGTGCAATCAAGTACATCCTTCGAGTTCTT
CGCGCCTTGACCGGGACGGCAAAGGAACTCAGTCTCTCGCCTCTGGCGAGCTCATTGCCATTGGACGCGGCTGCT
GCGGACAACAGCGAAGAGGAGTTTGCCTCAACGTCGTCGCTGTCAGATGTCGATGACGACCGAGAGGAGACTCCG
GATCTCTATCGCAACTCTGCCCTAGGCATGCTCGAGCCTCGCGCCGACGATGACGAGTCGGGCGAAGAGGACGAG
GGCGACGAGGACATGTACGGCGACGAGTACGACGACGAGGAGATGGACTACGGAGACGACGACACCTCGGAAGAC
GGCGAGGACAATATCAGCGAGGACGACGATGAGCTCAACGGAATGGGTGAGATTGAAGGCCTTCATGGCGAGCCG
GGCGTCGTCGAGGTCATCATGGACGAGGACGACGATGACACGGGCGACGATGAGGACGACGAGGAGATGGACTCT
GCTGACATGGAGGACCTGGAAGACCGCGTCGAGATTGTGGATGAAGAAGGAAATCCTCTCGATGAAGATGGAGAG
TCGGCTTGGGAAAGCGAGAGCGACGTCGAAGAAGTGGAAGACCAAGAGGCCGAGGACCTCGACTACGAAGCGGAA
AGGCAAGATGAGATGGAAGCTCATATCCACGACATGGGACCCGGTGGCTTGCTCGATAACATGGCTAGAGCCATC
ATGGGAGAAGACGACGGATACGAGCCGGAGCTGGATGTCGACAATGAGCATTTCATCGACGACGCTCATGATGAC
GGAGAAGAAGACGAGGAGGAGGACGACTTGGAAGACGATGGATACATCTACGACGAGGACTATCCTCTTGATGAA
CAACCGCCGCCGATGCCTGCCGGTCTGGGCTGGGACAGCTTCGATCCAGACGATGCACAGATCAGGCTCATGCTA
CTCGAAGCTGGTCAGAGGCGGTCCGTTCTTGCTGCTAGGATGGACAACCGCAGCCCGTTTCCACCCCGGTTCATG
GCCGGATCGAATCGAGAGCATATTGACTTCCGTACCTTTCTCTCGCGAGGGCACCGCTCGACGGGGGGTCAAGCG
AGCGCAGACGACGGCGTGAACCCTCTGCTTCGACCGCACCAGGCGCCGTCTGAAGCCGCGCCCCGTCCTGGACAC
AATCACTCGGTAGGGCTCAGGCTTCCCGAAGGCGTTTTTGGGGGCAGAAACGGGATCGACGGCCCGATGGATCTC
CTGGGCGAACTCATGGAGTTTCTCCCCATGATGGGTCGCAGCGCCGCCGGTCAAGCTTTCCATTTCCACATCACC
GGTCCCAACGGCCCGCGCGAGACGCGTGAGGTGAGCGCAACGCGATGGCCCAGGAACGAACAGCGTCGAGAAATC
TCGGCACAGGAACCCCATCAGGCGGTATCCTTCACGCCCGAGTCCACCCTCGAGCGCTATCAGGAGGAGGCCAGG
ATGATGTTCCGGGACGTTACGATTGAGGCCTCTAAACTGCACACCATCATCTTCGCGAAGCTCACGCCTGCGGCC
ATGGAGCTGGAGAGACGGTTGAAGGCGCGAGATGCCGAGGCGCAGAAGCGCGCGGACGAGGAGCGCAAGAAGCGC
GAGGAAGAAGACCGCAAGGCACGGGAGGCAAAAGCTGCCGAGGAGAAGGCGGCCAAGGAGCAAAAGGAAGCCGAG
GAGCGAGAGGCTGCGGAACGAGCGGCAGCAGCCATGGCCGCGGCAGCCGCTGCCACCGAAGCCGCTGCCAACGAG
GCCCACGACGATGGGAGCGGCGCCATGGAGGGCGTCGAGGCAGCCGATGCTTCAGGAACGAGCCGGGCTGGCGGC
AACGCGGCCCCGGACCCCGGCAGTCAGCGCAGAGTCATGACGACAATTCGAGGCGAGGAAGTGGACGTGACGGAG
CTCGGGATAGACCCGGACTACCTTGCGGCGCTGCCTGAGGAGTTCAGAGAGGAGGTGATTGCGCAGACGGTCAGC
GAGAGGCGATCTCAGGCTCGTGAGGAGGCAGCCACGGGCGAGTCGACGGAAGTTTTCCAAGAGTTCCTCGACGCC
CTGCCGGAGGAGCTTCGTCTGGAGATTGCGCAGCAGGAGAGGCAGGACGAGCGCCGTCGGGAACGCGAAGAGGCC
CGTCGCCAGGCTGCCCACGCTGGAGGTTCGGCGTCAGTGGGAGCCGAGATGGATCCCGCCAGCATTCTGCTCACC
TTCCCGCCCGAGCTGCGGGAGCAGGCCCTGATCGACCAGGGAGAGGATCTCATGGATCAGCTTCCTCCGGAGATG
GCGGCCCAGGCCCGGGCTCTGGCACAACAGCACGCGCCTCTTCCGCAGCATCGTGGCATCCGAAGCATCGTGGCT
CAAGGCAGATCGCCCCCCGGGGCTGGCAGGGCCGAAGCGCGCAACACGGCGGGAAATCAGGGCGAGAACAGAGTC
CAGCGGCGAACCGTGGTTCAGATGCTCGACAAGTCTGGAATCGCAACGCTGCTGCGGTTGATGTTCATTGCCCAG
CAAGGATCGATACGGAATTATCTTTTCAGCGTCTTTGCCGACGTCTGCGAGAACCGGCAGAACCGGCTCGAGGTC
GTCAGCAGTATCCTGCAGATCCTCCAAGAGGGTAGTGTCGATATGAATGCCGTCGAACGAAGCTTCGGCCAGCTC
TCGCTGAAGGCGAGAAAGCACAAGGAGAAGGAGGTCGAGCAGAAGACTCCGCAGAATCTCAAGAGGACTCTGACG
GGCCCAGCCGCGACCAGCAGCACGGCTCAGACCAACTCGGAAACGTCGCCCCTGCTCATAGTCCAGCAATGTTTG
GACCTCCTCGTGGACCTCAGCTCGAGGAGCCATCACATCCCCTGGCTCTTCTTGACCGAGCACGAGATTGTCGGA
ACGACGCTCAAGAGGGCTCTGAGCCGCAAGGGCAAGGTCAAAGACTCCAGGGCTCACAAGTACGCCATCAACTCG
CTGTTGACGTTGCTGGACCGCGACTTGGTGACGGAGAGCTCCATCGTCATGACGCATCTCGCCGACCTGCTGAAT
CGCGTCACTCTGCCGCTCCAGAACCTCGAGCGCCGGCGCAGGGAGATGGCAGAGGAGGCCAAGGCCTCCAAGCCG
GCGGCTGCGGCCGACGAGCCAGGCACGGGCGAAGCTGGCGAGGCGAGCGCTGGGCAGCCGTCGGATCAGGTCGAG
GGCGAGACGACGGTCAAGGACGAGACGGAGGAGAAGAAGGCGGCGGCTGCGGCGACGCAGAAGCGATCCCGGCAG
ACTCAACCGCCCGTGATCCCGCCGCAGAACCTGACGCTGGTTGTGCGCATCTTTGTGGCCCGAGAGTGCAACTCG
AAGACGTTCCAGAACACCATCTCGACCATCAAGAACCTCTCGGTGATACCGGGTGCCAAGGAGGCTTTTGGACAG
GAGCTTGTCCGTCAGGCGCGGCTCCTGAGCGAGAACATCGTTTCGGATCTCGACGACCTCTTGCCTCACATCGAC
CAGGCCACGACGGGCACCGAGATTCAGGGCGTCGCCCTGGCCAAGTTCTCTCCCGGAGCGTCTGAGCAGAACAAG
CTCCTACGGGTCCTGACGGCTTTGGACCACCTGTTCGACGCCAAGAAGAAGGCCAAGGACGTGGAGGACGCGGCG
ACCAAGGACCGGGAGAAGCAGTATCTCGTCACGTCGCTCTACCACAACTCGACCTTCTTGGCCATGTGGGATAAG
CTGAGCGCCTGCCTCCGGGCGATCCGCCAGCGCGAGAACATGCTCAACGTGGCGACGATACTGTTGCCCCTGATC
GAGTCGCTCATGGTCGTCTGCAAGAACACGACCAACGACGATCAGGCGGCCAGCCAGACGGCCATGAGGGACATG
GTCTTATCCAGCCCGCCTCCCGAATCGCGGACGGCCAGCCTGTTCTATAGCTTCACCGAGGATCACCGACGCATC
CTCAACGAGCTCGTCCGACACAACCCCAAGCTCATGTCGGGCACGTTTGCCTTGCTCGTTAAGAACCCCAAGGTG
CTCGACTTCGACAATAAGCGCAACTACTTCAACCGCAGCGTCCATTCGCGGAACGGCCAGACTAACGGGCGGCCG
TCGTATCCGACGCTCCAGCTGGCGGTCCGGCGCGACCACGTCTTCCACGACTCTTTCAAGTCGCTATACTTCAAG
TCCGGCGATGAGATGAAGTTTGGCAAGCTCAATATTCGCTTCCACGGCGAAGAAGGCGTCGATGCCGGAGGCGTA
ACGCGCGAGTGGTTCCAGGTCTTGGCCCGTCAGATGTTCGACCCGAACTATGCGCTCTTCATCCCCGTCTCGTCG
GATCGGACGACGTTCCACCCGAACAAGCTGAGCGGCATCAACGACGAGCATCTCATGTTCTTCAAGTTCATCGGC
CGCGTCATCGGAAAGGCCCTTTACGAGGGCCGCCTGCTCGACTGCTTCTTCAGCCGGGCCGTCTACAAGCGCATC
CTCGGCAAGTCGGTGTCGGTCAAGGACATGGAGTCGTTCGATCCGGATTACTACAAGTCCCTGTGCTGGATGCTG
GACAACGAGATCACCGACATCATCACCGAGACGTTTTCCGTCGAGAACGACGAGTTCGGCGTGACGACCGTCGTG
GACCTCGTGCCCAACGGTCGAGAGATTTCCGTCTCGGAGGAGAACAAGCACGACTATGTGCGGCTCGTGGTCGAG
CATAAGCTCCTGGCCTCGGTCAAGGATCAGATGGAACACTTCCTCAAAGGTTTCCACGAGATCATCCCCGCCAAG
CTCATCTCCATCTTCAACGAGCAGGAGCTCGAGCTGCTGATTTCCGGCCTCCCGGACATTGACATTGACGACTGG
AAGAGCAACACGGAGTACCAGAACTACACTCCGTCGTCGCAGCAGATCCAGTGGTTCTGGAGGGCCGTGAGGTCG
TTTGACAAGGAGGAACGGGCCAAGCTGCTGCAGTTCGTCACCGGCACCAGCAAGGTTCCCCTCAACGGCTTCAAG
GAGCTCGAGGGCATGAACGGCGTCAACCGGTTCAACATCCATCGCGACTACGGCAACAAGGATCGTCTTCCGTCC
TCGCACACGTGCTTCAACCAGCTCGACATCCCCGAGTACGACACTTACGACATGCTGCGCTCGCAGCTGCACAAG
GCCATCACTCAGGGAAGCGAATACTTTGGTTTCGCCTGA
Gene >Ophcf2|06565
ATGGGCAAAATCATCAAAACTATGCAGCAGAGGCATAGGGAGACCTTGGTGAGTTTTCCTTTCTTCGTCATCGGT
ATACGTCGCTGATCTCGTGAAACCGGTAGTCTCCTTGGCTTCGAGGCTACATACACTCTGCCTCGACGCTCGCGC
TGCCTCTGCTACCGTCGCGTCTCGCCACTTTCCCCTCGAGATGGCCCTTCGGCCGTGGTGATCTCTACCACTGGA
TCCCCCTGTTGAACCGCTTTGACAGTATTCTCGACCAGTTCTGCAAAATCTACCGTCTGCACGAGGGCCCTCAAT
CCTGTGACTTCGGCTGCGACCTACTTCTGAATACAAACAGAGAGTCGGCCTTTGCCAAGGAGAATAGTTGGGATG
AACAGGAGCTCCAAAACCATGGCTTCTCCGCTCAAGGCGACCGCGAGCTCGTCGAGGCTGTTCTTCGCTTCACCC
GCATGTTACTCGAGCACTGCGGCAACCGAAGTATCTACGCCAGCAGCGCTCATCTCAACGACCTTCTCAACAGCT
CGTCGCTGTCCGTCGTCATCGCCACCCTAGAAGTAGGTTCCGAGTTGGCCCAGCGCTATCAGGCCTCTGTCAAGC
GCATCGGCAGCTCGTCTCGGCAAATTAGTGCCGCCCTGCTGGCCAACCACTACAATATCGACCTCGAGCGCGTCC
AGCAGATTGCCTTGCCCTTTTCCAAGACCCCAATCATCGGCCTCTGCGACTTCACGTCGTCGACCACCCCGGCCT
CGGCCAAGGGTAAGGAAAAGGCACAGACTTCGACTGGACGGGCCACGACATCCATTCACGCAAACGACCTCGTTG
CTATCGCGACCGCAGACGATAAGCACTGGACGGACTGGACGGATGTCAGGGTCATCTATTACCCGCAAGACTCCC
CGACCAGCAATGAGGCGGTCACCGATGCCGCCCGTTCGACCCAGCCTTCGACGCCGACACCCCTTCGCCGGAGCT
CGACCATGGGCAACCAGCAGCATACCCCAAAGCCACGCAACACTGTTAATGATGACGCTTCTTCGCCCATCACAC
CCCGCACTCCCGCCGTCGCCGACGAGCATAATTCTCTGGGCCAAAAGTCGTTCGAGGTTCCAAGGTCTGCGGTCT
TGACGACGCCTATCTATGACCTCGTCCAGCGTTGCCCGGATGACATGCCTTCGGCGGCCAAGTACGATCTTTTCC
AGAGACTTCGTGCCGCCAAGGCCCTCACTGGCACGATCGAGGAGCGGCGTCAGATTCTGGCCGCTCGGCTGCTTG
CAATAACCAATTTGGCGTACATTCACATCGAGTCTACTTTCGTGGACAAAGTCTTGCGCCAAGATATTGATGAGA
CGCGGAGATATCAGCTCGTCTATCAGTTGGCAGAGCTCATTCATCCGTCGGCGGACGGCAAGACTGACGTGCCCA
TGTGGTTGCAATCGATCGCCTTGGCTTTGCTAGAGGCTATTTCGGGATTCCACGCCAGGTGTCAAGATGTCCTGT
CCGCCCTCAACGCGAATGTGAACCATGGCATCTTGCTCTACGTCATACGAAAAGCCGTGGCGGGCATGGCGGAAG
ATGGCGCTTCTGACGCCGATGAGCAAGTTACAGTCGCGGACGAATGGAGGAACAACCTCTTCTCCCTGACGCTGC
ACTTGTCTATGAACACGCGAGTTGGGAGTGAGATGGCGTCTGCTGGGCTAGTGGACATTCTGGTTGAAATCCTTA
GTCTTCGTTCCCAGATCTCCCAGCGCCATCATGCCATGGTTTTGGCTTTTCTTGACGGGCTGATTTGGACCTATC
AGACTGCCTTTACGGCTTTCATCAACGCCAGCGGCTTGGGTACGGTGGCGAGACTGCTCGTGGACACCGTCGCCG
AGGCTCGCAAGTCGCTCGGCTCTTCCAAGGGCATCAAGGCGGATCAGCAGTCTAGTGCTGTCGACTACGAAGTCC
CGTACTATCAGCAACAGACTCTAAAATGGCTCCTGAAGTTCATTCACCACGTCATGTCCAATTCTTACACGTACA
ACGGGAACACGGACCGGCTCGTCCGCAATCTTGCAGAGAAGTCGGATCTGTTGCGCAGCCTGCGGGAAATTATGG
AAGACAAGAAGAGCTTCGGTTCGGTGGTCTGGACGAACTCGGTTACGATCCTCAGCGACTTCATCAACAACGACC
CGACTAGCTTTGCAGCCATTTCAGAATCCGGCATGATTAGGACCTATCTCGAGGCCATCACGGGCCGGCCCATTG
CAGATAACCACGGCGACCAGAAGCCCAAGGATAACGAGCATAGGGACAGGGACGATGATGAATCCCCAGACAGCC
CGGCCCTCGCCTCCATCGTCGAAAACGACGACCGTCCTCACCCACCCCCGGTGGAGTTGCTACGGCAGGGTCGAA
CTCAGCCGCTGGCCCAGGGGATCCTGGCCTCTGGCGAGGCCATCAACGTCGTTCCCCAGGTGCTAAACTCCATAT
CGCTCAACAACACCGGCATGAAGCTTGTGATTGCCTCGCGAGCCTTTGACAGCTATCTGGAGATATTCGAGAGCC
CTGCTCACGTCAAGTGCATGGACACGGATGGCGACCTCGCTCACAACGTCGGCAGCAGCTTCGATGAGCTCGCTC
GTCATCATCCTCCTTTGCGGACCTCCATCTCAAACGCCGTCATTGACATGGTTGCGAGAGTGCGCTTCCTTGGCA
TCGAAAAGGCACGCACGTGCGGTTGGGGCGCGAAGCTGTTTCTCAGCGGCGCCAACGGCGAGATCCTGTCTGTCA
ATGAGCTCGGCAAGCTCGAGGACGCGAGCAAGTTGTCGCCTCAAGCGCGGGAGGACGATGCCGATGTCGAAATGT
CCGACGCGGTGCCGCAGGACGAAGCAAAAGCAGGTCGACGCGATGACGAGAACGATACGGGCACGTCTGCCGAGT
CCATCACGCCCTACATCCATGCTCTGGCCACCTTCCTCACGTCGTATCTGTCCAACCCTCTGCTGAAGACCAACT
TCATCAAGAAGGGGGGCATCGAGCTGCTCCTCGACATTTGCGAGTCGCCCAGCCTGCCGGCCACTTTCGGCGACT
CCGCTGCATCTCGATCCTTGAACCAGGTGGTATCTCAGCTGGTCGAGCATTCGCCCATCCGCGCCTTGCCCTCGG
TGCTGCGCCGCGCTCAGGCCGCCATTGACGTGCTCAAGCCGCTCGCCGACAAGACGGGGACGATTCCTCCTTACT
TTGCGCCCTTCCTCGTGCCCGATCTGGGCCTCGTCCAGAACGGCTCCGATGCTCCGCCCACCGTCTTGGAGGGGA
ACTTGCTGGTCAAGGCACTTTTGAATGCGCAGACCTTTATGAAGATTGTGTCTGACTGCTTCTTGACCTCGAGGA
ACAACGTCTTGACCTTTTATCCGGTCAATGTCTATGACTACTACCTCGGCCTGATAAAGTCGGTCGGGCCCCTCT
TGCGTGGTGTTCTGGTCGAGGAGGCAGCGCAGTTGTCTGTCATCCCCCAGCATTGGTCCTTGAGACGTCACCCGC
CCACGGCCGAAAGCGGCGCCCGGGACGGCGACGTGGACACCGACGACACATCTCTGCCGGAGGCGCTGAATAGTG
CGACCGGATGGGAAGCGGCTCGAGACAACGATGGCGCTTCGGCGACGCGACCCACGCAACAGGAGCAAGCCAGCC
CGCGTTTCCAGAACTACGAAACTCTACGCGTCTTGCTGCACCCAATGATTCCGACTTCTTTCCCGCTGTTTCAAT
CCTTAGGGAAGTCGCTTCTGCCCCGTCGCAACGACCAGAACCATCCTGAGCCTTATACGAGATCTCGTCACCTCG
AGATTGCCAAAGCTCTGGCCGATTCTGTTCTCAGCCATCTGGCTCCATCCGTTGCCACGCCAGAACCGTCTTCCA
AGGATTTCCACTACTGGATCATCATGCTCCACACCATTCATGAGATGCTCATCGACCATCCTACATCGAGGCAGA
ACGACCGCTCTAACATGCACATCATAATGCCTGTCCTACTAGCATTCAAGGAACGCGGCGGCTTGGATGTGCTCA
ACTCTATGTTGAGGGTCTTCACCAGCGCCATCCAACAGGGTGCTGACGGCGCTTCCGACGAGACGTCCAAGAGCA
AGGTCGCTGCCTTTGGTCTGAAGAAGGTGCTCGACCTGTATTACTACCTCGTCGACGGGAAGCACCTATCGGAGA
CTGCAAACTTTTTCAATCTGCAGCCCCGTCACCCCGATAGGCCGAGCCCGACCGTTGTCTGTCAGCAGATCGTTG
TGCAGTTCCGTACGGCCGTGTTGTCGGCCGTCATGGAGCTCTTCAACGGGACCTTTCTCCACAAACTTCCGGGTG
CCACAGCCAAGCGGCTGCTTGACATCCTCAAAGTAATCGCCGGTGCTGATCATGAGCTTCAAAACTCCAGCTCGC
AACACACTTCTTTCAACCTCTTCTGCCACAAGGATGCTCGATTCGACTGGCAGCCTCTCCGCGGCGTCGTCAACG
AGCTCCTCGGCACGGGCTTTGACGAGGGCTTGGTGCACGAGGCGGCGTACAGAGCCAATGGCAACAGCGGTTTCG
CCACTGAATATTGCCAGGCCCACAAGGATGGCCTGGCCGGCCTGCGGAACCCGATTCCGCCAGAAGACGCGGACC
TCTCTGCGTTGACAGAGCCCGACACACCTGTCAATAACAATCCGGAGACTTCGACAAACGAAAGAGAGGCTTCCA
ATGGGTCAGCCGTGTCCGACGCCGATCGCATGTCGCTGGATGCGCTGCCTGATCTGACTGCCGAGGGGCTTCGGG
ACATGATTGAGCGCCCCAACCAGGTGGAAGAGGCTCAGCAGACAGGGTCTGGACCCGCGCCCGCTACACCAACAG
TTGCGCCTGCAGACGATGCCAGTCGAGATGATGGAGCTCTAATCCTAGCCACGAAGGAGAAGCTGGATAGTCTCA
GGGCAAATCTCAGGCTCGACCTGGTTGACTCATGTCTGGACGTTCTTCGCGCCCACCCGGACACGGCGACGGACG
TCCATGAGCTCATCGTGGTAATGGCTCTCAGACGGCAGAACTTCGAAGCGTACACCGACGTTGGTTCCACGCTGA
TCTTCGCGCTGACTTCGATCGCCCACGACGACGAGGAAGAGAAGAAGTACACTGGAAAATTCATCGCCGCCTATG
CTCATCTCTTGGCACTCCTTGTTCAGGACGCTCATTTCCTCGAGGCAAACATGGAGAATTTACGGGAAAAGGTCG
ATGAGTACGTGAGCCTCCTGAAGCTGCCAATGTCTTCTTCGTCCGAGGACTTGCCGCCCTGGATCCCTTTCGTCC
TCTTGGTTCTCGAGCTCTTCCTTTGCCACGACGAGCGGCTTGTCGCCGCACAGTGGAAGGGCCCCAAATCGCTTG
AGGAGACATGTTCGGCTCCGGTCATCCAGGCGGGGACGTCGTTGATCGGCGACCCTGACCGCACCAAAATACTGG
ACTCGTTGCTTGAGTTGCTTCCCCGAATCGGCAAGGAAGAGATGCTGGCAACTGCGGCTCTGAGGGTCCTCGTCA
TCCTGACTCGACGCCGCCAGGCGGCGAAACTTGTCGGCGAGAAGCGAAACTTGCAGAGGCTGTTTCTTATGGCCA
AACAGCTGTCTGGGTCTGGCTCTGAGCGCCTCAAACAGACGAGATTGACCGCGTACATCATCACCATTCTGCGCC
ACGTCATTGAGGACGACGAGATTGTCAAGCAGGTCATGCGTGCCGAGATCCAGGCCGACTTTCCCAACATACAGC
GGAATCAGCGCGGGCCTGTTGATGTGTCGACGTATCTGCGGGCCATGGCCCCGGTTGCTCTTCGAAACACAGATT
TGTTCGTCGAGGTCACGAACGAGCTGGTGCAGTTTACCAGGTGGCAGCCCCCGTCTGCTGAATCCAGTCGTTCGC
AGGGTCTGGCCCTCAAGAGCGCTTCTAAGGAAGGATCCGAGACTGTCGATCCACCCGTCGAAAGTTCCCCGACCC
AGGATATCAAGCCGTCGACCGAGACTGCGGACAAGGACATGATGGATGCGCCCAAGGCACCCCAGCACGACAGCA
AGCGACCGATCGTCGAGAACCCGGACGGCGTCATTCATTTTCTTCTCTGCGAGCTCGTCAATTACCGCGAGGTGG
ACGACAAGGAGCCGGTCACTCTCGGCAAAGAGGGCAGGGCAGATGGTGAGTCGTCTACGCCTGGTCGAGACTCCG
GGGTCAAGGACAAGCCAGCCTCGGAAGAGAGAGACAAGAAGCAGACGAAACCGGTTTTCAAGGCCGTGGAGCATC
CGATATTCGTGTATCGATGCTTCCTCCTAAGTTGCCTCGCCGAACTCCTGCAGAGCTACGTCAGGACCAAAGTCG
AGTTCATCAACTTTAAGCGCAGCGCACCTCCCGCTACATCCCAAACGCCGGTCAAACCCAGGTCCAGCATCCTCA
ACTATCTGATCTACGACCTGCTGTGCCAGGGGAACCTCACTGGGACGACGGACAGCATCGCATCCAAGAAGAAAG
CCGCGACGTCGTCGTTGACGCAGCGGGTTCTTGTAGCACTCGTCGCCAAAACCAGCGAGCGACCAGTGGAGCGCA
ATCGCGACAAGTTTGCGTACGACGACGAGCCCGATCTTCTCTTCGTCCGCAAGTTCGTCCTCGACACGATTCTCA
AGGCCTACGAAAAGGCGCCGCTTGCGGATGAGCCTCTTGAGACGAGATACACTCGGATGCAGTGCTTGGCGGAGC
TCATGAATCAAATGATTGGCGAGAAGGAAAAGGATCAAAACTCCGGATCTCGAGCGGCCGACAACGTACAGAACC
GTTCTCAAGCGCAGCTGCGTCGGTTGATGTACGAGAAGGGATACGTGGAGAAGCTGACGTCGTCAATTGCCGAAG
TCAGCCTAAACTATCCCGGCGTCAAGCGTGCAATCAAGTACATCCTTCGAGTTCTTCGCGCCTTGACCGGGACGG
CAAAGGAACTCAGTCTCTCGCCTCTGGCGAGCTCATTGCCATTGGACGCGGCTGCTGCGGACAACAGCGAAGAGG
AGTTTGCCTCAACGTCGTCGCTGTCAGATGTCGATGACGACCGAGAGGAGACTCCGGATCTCTATCGCAACTCTG
CCCTAGGCATGCTCGAGCCTCGCGCCGACGATGACGAGTCGGGCGAAGAGGACGAGGGCGACGAGGACATGTACG
GCGACGAGTACGACGACGAGGAGATGGACTACGGAGACGACGACACCTCGGAAGACGGCGAGGACAATATCAGCG
AGGACGACGATGAGCTCAACGGAATGGGTGAGATTGAAGGCCTTCATGGCGAGCCGGGCGTCGTCGAGGTCATCA
TGGACGAGGACGACGATGACACGGGCGACGATGAGGACGACGAGGAGATGGACTCTGCTGACATGGAGGACCTGG
AAGACCGCGTCGAGATTGTGGATGAAGAAGGAAATCCTCTCGATGAAGATGGAGAGTCGGCTTGGGAAAGCGAGA
GCGACGTCGAAGAAGTGGAAGACCAAGAGGCCGAGGACCTCGACTACGAAGCGGAAAGGCAAGATGAGATGGAAG
CTCATATCCACGACATGGGACCCGGTGGCTTGCTCGATAACATGGCTAGAGCCATCATGGGAGAAGACGACGGAT
ACGAGCCGGAGCTGGATGTCGACAATGAGCATTTCATCGACGACGCTCATGATGACGGAGGTCAGTGAAACCCCC
TACTTCCCCAATGAGTGTGGTGTGCTGACCATCTCATGCAGAAGAAGACGAGGAGGAGGACGACTTGGAAGACGA
TGGATACATCTACGACGAGGACTATCCTCGTATGCCTCACCCTCCCCCCGATGTCTACCGCTCCGGTATAGACAT
GGCTGAAATATATCCCGCGTTTCCAGTTGATGAACAACCGCCGCCGATGCCTGCCGGTCTGGGCTGGGACAGCTT
CGATCCAGACGATGCACAGATCAGGCTCATGCTACTCGAAGCTGGTCAGAGGCGGTCCGTTCTTGCTGCTAGGAT
GGACAACCGCAGCCCGTTTCCACCCCGGTTCATGGCCGGATCGAATCGAGAGCATATTGGTCGGCAGTTTTGGCT
CCGTGGGCGACGAAGAAATGCTAACGGCGAAGTCACAGACTTCCGTACCTTTCTCTCGCGAGGGCACCGCTCGAC
GGGGGGTCAAGCGAGCGCAGACGACGGCGTGAACCCTCTGCTTCGACCGCACCAGGCGCCGTCTGAAGCCGCGCC
CCGTCCTGGACACAATCACTCGGTAGGGCTCAGGCTTCCCGAAGGCGTTTTTGGGGGCAGAAACGGGATCGACGG
CCCGATGGATCTCCTGGGCGAACTCATGGAGTTTCTCCCCATGATGGGTCGCAGCGCCGCCGGTCAAGCTTTCCA
TTTCCACATCACCGGTCCCAACGGCCCGCGCGAGACGCGTGAGGTGAGCGCAACGCGATGGCCCAGGAACGAACA
GCGTCGAGAAATCTCGGCACAGGAACCCCATCAGGCGGTATCCTTCACGCCCGAGTCCACCCTCGAGCGCTATCA
GGAGGAGGCCAGGATGATGTTCCGGGACGTTACGATTGAGGCCTCTAAACTGCACACCATCATCTTCGCGAAGCT
CACGCCTGCGGCCATGGAGCTGGAGAGACGGTTGAAGGCGCGAGATGCCGAGGCGCAGAAGCGCGCGGACGAGGA
GCGCAAGAAGCGCGAGGAAGAAGACCGCAAGGCACGGGAGGCAAAAGCTGCCGAGGAGAAGGCGGCCAAGGAGCA
AAAGGAAGCCGAGGAGCGAGAGGCTGCGGAACGAGCGGCAGCAGCCATGGCCGCGGCAGCCGCTGCCACCGAAGC
CGCTGCCAACGAGGCCCACGACGATGGGAGCGGCGCCATGGAGGGCGTCGAGGCAGCCGATGCTTCAGGAACGAG
CCGGGCTGGCGGCAACGCGGCCCCGGACCCCGGCAGTCAGCGCAGAGTCATGACGACAATTCGAGGCGAGGAAGT
GGACGTGACGGAGCTCGGGATAGACCCGGACTACCTTGCGGCGCTGCCTGAGGAGTTCAGAGAGGAGGTGATTGC
GCAGACGGTCAGCGAGAGGCGATCTCAGGCTCGTGAGGAGGCAGCCACGGGCGAGTCGACGGAAGTTTTCCAAGA
GTTCCTCGACGCCCTGCCGGAGGAGCTTCGTCTGGAGATTGCGCAGCAGGAGAGGCAGGACGAGCGCCGTCGGGA
ACGCGAAGAGGCCCGTCGCCAGGCTGCCCACGCTGGAGGTTCGGCGTCAGTGGGAGCCGAGATGGATCCCGCCAG
CATTCTGCTCACCTTCCCGCCCGAGCTGCGGGAGCAGGCCCTGATCGACCAGGGAGAGGATCTCATGGATCAGCT
TCCTCCGGAGATGGCGGCCCAGGCCCGGGCTCTGGCACAACAGCACGCGCCTCTTCCGCAGCATCGTGGCATCCG
AAGCATCGTGGCTCAAGGCAGATCGCCCCCCGGGGCTGGCAGGGCCGAAGCGCGCAACACGGCGGGAAATCAGGG
CGAGAACAGAGTCCAGCGGCGAACCGTGGTTCAGATGCTCGACAAGTCTGGAATCGCAACGCTGCTGCGGTTGAT
GTTCATTGCCCAGCAAGGATCGATACGGAATTATCTTTTCAGCGTCTTTGCCGACGTCTGCGAGAACCGGCAGAA
CCGGCTCGAGGTCGTCAGCAGTATCCTGCAGATCCTCCAAGAGGGTAGTGTCGATATGAATGCCGTCGAACGAAG
CTTCGGCCAGCTCTCGCTGAAGGCGAGAAAGCACAAGGAGAAGGAGGTCGAGCAGAAGACTCCGCAGAATCTCAA
GAGGACTCTGACGGGCCCAGCCGCGACCAGCAGCACGGCTCAGACCAACTCGGAAACGTCGCCCCTGCTCATAGT
CCAGCAATGTTTGGACCTCCTCGTGGACCTCAGCTCGAGGAGCCATCACATCCCCTGGCTCTTCTTGACCGAGCA
CGAGATTGTCGGAACGACGCTCAAGAGGGCTCTGAGCCGCAAGGGCAAGGTCAAAGACTCCAGGGCTCACAAGTA
CGCCATCAACTCGCTGTTGACGTTGCTGGACCGCGACTTGGTGACGGAGAGCTCCATCGTCATGACGCATCTCGC
CGACCTGCTGAATCGCGTCACTCTGCCGCTCCAGAACCTCGAGCGCCGGCGCAGGGAGATGGCAGAGGAGGCCAA
GGCCTCCAAGCCGGCGGCTGCGGCCGACGAGCCAGGCACGGGCGAAGCTGGCGAGGCGAGCGCTGGGCAGCCGTC
GGATCAGGTCGAGGGCGAGACGACGGTCAAGGACGAGACGGAGGAGAAGAAGGCGGCGGCTGCGGCGACGCAGAA
GCGATCCCGGCAGACTCAACCGCCCGTGATCCCGCCGCAGAACCTGACGCTGGTTGTGCGCATCTTTGTGGCCCG
AGAGTGCAACTCGAAGACGTTCCAGAACACCATCTCGACCATCAAGAACCTCTCGGTGATACCGGGTGCCAAGGA
GGCTTTTGGACAGGAGCTTGTCCGTCAGGCGCGGCTCCTGAGCGAGAACATCGTTTCGGATCTCGACGACCTCTT
GCCTCACATCGACCAGGCCACGACGGGCACCGAGATTCAGGGCGTCGCCCTGGCCAAGTTCTCTCCCGGAGCGTC
TGAGCAGAACAAGCTCCTACGGGTCCTGACGGCTTTGGACCACCTGTTCGACGCCAAGAAGAAGGCCAAGGACGT
GGAGGACGCGGCGACCAAGGACCGGGAGAAGCAGTATCTCGTCACGTCGCTCTACCACAACTCGACCTTCTTGGC
CATGTGGGATAAGCTGAGCGCCTGCCTCCGGGCGATCCGCCAGCGCGAGAACATGCTCAACGTGGCGACGATACT
GTTGCCCCTGATCGAGTCGCTCATGGTCGTCTGCAAGAACACGACCAACGACGATCAGGCGGCCAGCCAGACGGC
CATGAGGGACATGGTCTTATCCAGCCCGCCTCCCGAATCGCGGACGGCCAGCCTGTTCTATAGCTTCACCGAGGA
TCACCGACGCATCCTCAACGAGCTCGTCCGACACAACCCCAAGCTCATGTCGGGCACGTTTGCCTTGCTCGTTAA
GAACCCCAAGGTGCTCGACTTCGACAATAAGCGCAACTACTTCAACCGCAGCGTCCATTCGCGGAACGGCCAGAC
TAACGGGCGGCCGTCGTATCCGACGCTCCAGCTGGCGGTCCGGCGCGACCACGTCTTCCACGACTCTTTCAAGTC
GCTATACTTCAAGTCCGGCGATGAGATGAAGTTTGGCAAGCTCAATATTCGCTTCCACGGCGAAGAAGGCGTCGA
TGCCGGAGGCGTAACGCGCGAGTGGTTCCAGGTCTTGGCCCGTCAGATGTTCGACCCGAACTATGCGCTCTTCAT
CCCCGTCTCGTCGGATCGGACGACGTTCCACCCGAACAAGCTGAGCGGCATCAACGACGAGCATCTCATGTTCTT
CAAGTTCATCGGCCGCGTCATCGGAAAGGCCCTTTACGAGGGCCGCCTGCTCGACTGCTTCTTCAGCCGGGCCGT
CTACAAGCGCATCCTCGGCAAGTCGGTGTCGGTCAAGGACATGGAGTCGTTCGATCCGGATTACTACAAGTCCCT
GTGCTGGATGCTGGACAACGAGATCACCGACATCATCACCGAGACGTTTTCCGTCGAGAACGACGAGTTCGGCGT
GACGACCGTCGTGGACCTCGTGCCCAACGGTCGAGAGATTTCCGTCTCGGAGGAGAACAAGCACGACTATGTGCG
GCTCGTGGTCGAGCATAAGCTCCTGGCCTCGGTCAAGGATCAGATGGAACACTTCCTCAAAGGTAAGACGACTTC
CGGACCAGTCCCTTCCTCAACCTCGGCGTTTTTTGACGGATTACTGACGCCGTACATTGGCAGGTTTCCACGAGA
TCATCCCCGCCAAGCTCATCTCCATCTTCAACGAGCAGGAGCTCGAGCTGCTGATTTCCGGCCTCCCGGACATTG
ACATTGACGACTGGAAGAGCAACACGGAGTACCAGAACTACACTCCGTCGTCGCAGCAGATCCAGTGGTTCTGGA
GGGCCGTGAGGTCGTTTGACAAGGAGGAACGGGCCAAGCTGCTGCAGTTCGTCACCGGCACCAGCAAGGTTCCCC
TCAACGGCTTCAAGGAGCTCGAGGGCATGAACGGCGTCAACCGGTTCAACATCCATCGCGACTACGGCAACAAGG
ATCGTCTTCCGTCCTCGCACACGTGCTTCAACCGTAAGTCTTGTCCTCTCACCGTCTCTCCTACGACATGAAGCT
GACCAGCATGCCAGAGCTCGACATCCCCGAGTACGACACTTACGACATGCTGCGCTCGCAGCTGCACAAGGCCAT
CACTCAGGGAAGCGAATACTTTGGTTTCGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail