Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06564
Gene name
Locationscaffold_08:440536..443671
Strand-
Gene length (bp)3135
Transcript length (bp)2733
Coding sequence length (bp)2733
Protein length (aa) 911

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 2.3E-48 504 686

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6185 0.2804 0.0721 0.2085 0.085 0.0031 0.2138 0.4323 0.4928 0.0101

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5102
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2082
Ophiocordyceps australis map64 (Brazil) OphauB2|7486
Ophiocordyceps camponoti-floridani Ophcf2|06564 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3634
Ophiocordyceps kimflemingae Ophio5|818
Ophiocordyceps subramaniannii Hirsu2|3176

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06564
MEDPKPSRPAGDEESLAAEANHDTAFEHESFEDAVDVPAHVVPVDVHTADTVSVRSLTKRAVAVTQSPASDESDD
TEASVVDDKEEVEEKDASDEKDGVDNVRHRSDGEKDGVDDKDDTNRAAQKPVPDARSEVPIPPQSQARPPSRHQS
PAHSSRISSTANLDNVNLDDEAAIKHQEPPSPVPKEQPSKKLSLGSLAGALPSMPWNPPNDTSSKGSGPPLTAGT
SSQPPAPTRKLTSPFSWLSRNTTSKDKESQPSPPAQTSPRRNTASSVATLMSNPEMMLSRLEEDKDGGRRGSNRE
SLKDRFKALRLREESGMSTPAADGDKAGGALGLVNQDDETVAGEMPPPSPVPGPNIGLAPGTMSGINAGPSAMPD
TRVDWDLWQSVVYEGPAAVARSSAEELNRAIATGIPNAIRGVVWQVLAQSKSDGLEVVYRELVARGTEKDRDRHS
NSTTTSSISNASLSAHSGDAPTSSASSVHSEQSGATGEKGSDAVVRPTAISPEERKKKTKENAAALQKLEKTIRR
DLGARTSYSKYAAASGLQDGLFGVCKAYALYDEGVGYAQGMNFLIMPLLFNMPEQEAFCLLVRLMNQYHLRELFI
QDMPGLHMHLYQFERLLEDTEPALYCHLHRRGISSHLYATQWFLTLFAYRFPLQLVLRIYDLIFSEGLSAILRFG
IVLMQKNAATLLALSDMQQLTTHLKDKLFDVYIDKDPSQGSILENGFFGSSTASQDKEVYRADQLVRDACEVKIT
PELLKAYTSEWEEKTRAERGREAELQDLSQANQSYAAQVRKLEERVEACDREQTALATEMVHTKVENEELRDENE
SLKGQVRELKVVIEKQPADIEASWKLERDDLMKRNGHVHEENQRLEKELAELEEELVQTKMHYAELHSQHETLNR
KWADLKRQFA*
Coding >Ophcf2|06564
ATGGAGGATCCCAAGCCATCACGTCCTGCAGGCGACGAGGAGTCGTTGGCTGCGGAAGCGAACCATGATACGGCT
TTCGAACACGAGTCCTTTGAGGACGCTGTCGATGTTCCCGCCCATGTCGTTCCCGTCGACGTCCACACTGCTGAT
ACCGTCTCGGTTCGCTCCCTGACCAAGAGGGCTGTGGCCGTCACCCAGAGCCCGGCTTCGGACGAGTCCGACGAT
ACCGAGGCCAGTGTCGTCGACGACAAGGAAGAAGTCGAGGAAAAGGACGCAAGCGACGAGAAAGACGGAGTTGAC
AACGTCAGACACAGAAGTGACGGAGAGAAGGACGGAGTCGATGACAAGGACGACACCAACAGGGCCGCACAAAAA
CCAGTTCCCGACGCTCGAAGTGAAGTCCCCATTCCACCTCAGTCGCAGGCCAGGCCACCGTCTCGTCATCAATCA
CCCGCTCATTCCAGCCGCATTTCCAGCACCGCGAATCTCGACAATGTCAATCTGGATGACGAGGCAGCAATCAAA
CACCAAGAACCCCCGAGCCCCGTACCTAAAGAACAGCCAAGCAAGAAGCTGTCTCTCGGCAGTCTTGCTGGCGCC
CTCCCTTCTATGCCGTGGAACCCTCCGAACGACACATCCTCCAAAGGCTCTGGGCCACCGTTAACCGCCGGCACT
TCCAGTCAGCCGCCGGCACCAACCAGGAAATTGACGAGCCCTTTTTCCTGGTTATCCCGCAACACAACAAGTAAG
GATAAGGAAAGCCAACCGTCGCCTCCCGCCCAGACCTCTCCGCGGCGCAACACGGCCAGCTCAGTGGCTACCCTC
ATGAGCAATCCGGAAATGATGCTCAGCAGACTGGAGGAGGACAAAGACGGCGGTAGGCGGGGCTCGAACCGCGAG
AGCCTCAAGGACAGGTTCAAGGCTCTCCGGTTACGAGAGGAGAGCGGCATGTCGACACCCGCAGCCGACGGCGAC
AAGGCCGGCGGAGCGTTGGGCCTCGTCAACCAGGATGACGAGACCGTAGCTGGCGAGATGCCCCCTCCCTCGCCC
GTGCCCGGGCCCAACATCGGCTTGGCCCCGGGAACCATGTCGGGAATCAATGCCGGCCCCTCGGCGATGCCGGAC
ACGCGGGTCGACTGGGACCTGTGGCAATCCGTCGTCTACGAAGGCCCGGCGGCCGTGGCTCGGTCGAGTGCAGAA
GAGCTCAATAGGGCCATCGCGACGGGCATTCCCAATGCCATCCGCGGAGTCGTCTGGCAGGTCCTGGCCCAGAGC
AAGAGTGACGGCCTCGAGGTTGTCTACAGGGAACTAGTCGCTCGAGGCACGGAGAAGGACAGGGATCGGCACAGC
AATAGCACGACGACGAGCTCCATTAGCAATGCGAGCCTCAGCGCCCATAGCGGCGACGCGCCCACGTCGTCTGCG
TCGTCGGTGCATTCTGAGCAATCCGGCGCCACCGGGGAGAAGGGTTCGGACGCCGTGGTCAGGCCGACGGCCATC
TCTCCCGAGGAGCGCAAGAAGAAGACCAAGGAAAATGCGGCAGCGCTCCAGAAGCTGGAGAAGACGATCCGCCGC
GATCTCGGCGCCCGCACGAGCTACTCCAAGTACGCGGCTGCCTCGGGGCTTCAGGACGGCCTCTTTGGGGTTTGC
AAGGCGTACGCGCTGTACGACGAAGGCGTCGGCTACGCGCAGGGCATGAACTTCCTCATCATGCCGCTGCTGTTC
AACATGCCGGAGCAAGAAGCCTTTTGCCTCCTGGTGCGCTTGATGAACCAGTACCATCTGCGGGAGCTCTTCATC
CAGGATATGCCCGGGCTGCATATGCACCTGTATCAGTTCGAGCGCCTCCTCGAGGACACGGAGCCGGCGCTGTAC
TGTCACCTGCACCGGCGCGGCATCTCGTCTCACCTGTACGCGACGCAGTGGTTCCTGACGCTGTTTGCTTACCGC
TTCCCGCTGCAGCTGGTGCTGCGCATCTACGACCTGATCTTTTCAGAAGGCCTGTCGGCCATCCTGCGGTTCGGC
ATCGTGCTGATGCAGAAGAACGCAGCAACGCTGCTGGCCCTTTCGGACATGCAGCAGCTGACGACGCACCTCAAG
GACAAGCTCTTCGACGTCTACATCGACAAGGACCCGAGCCAGGGTAGCATCCTCGAGAACGGTTTCTTCGGCAGC
TCAACCGCGAGCCAGGACAAGGAGGTGTACAGGGCGGACCAGCTAGTCCGCGACGCGTGCGAGGTCAAGATCACG
CCCGAGCTTCTCAAGGCCTACACGTCCGAATGGGAGGAAAAGACGCGAGCCGAGCGCGGCCGCGAGGCAGAACTA
CAGGACCTCAGCCAGGCCAACCAGAGCTACGCCGCGCAGGTGCGCAAGCTGGAAGAGCGCGTCGAGGCCTGCGAC
CGCGAGCAGACGGCGCTGGCGACGGAGATGGTGCACACAAAGGTCGAGAACGAGGAGCTGCGGGACGAGAACGAG
AGTCTCAAGGGTCAGGTCCGCGAGCTCAAAGTCGTGATTGAGAAGCAGCCGGCCGACATTGAGGCTTCGTGGAAA
CTTGAGAGGGATGACCTCATGAAGCGCAACGGTCACGTCCACGAGGAGAATCAGCGGCTTGAAAAGGAACTTGCC
GAGCTGGAGGAGGAGCTGGTGCAGACCAAGATGCACTATGCCGAGCTTCACTCCCAGCACGAAACCCTCAACCGC
AAATGGGCAGACCTAAAGCGCCAATTCGCCTGA
Transcript >Ophcf2|06564
ATGGAGGATCCCAAGCCATCACGTCCTGCAGGCGACGAGGAGTCGTTGGCTGCGGAAGCGAACCATGATACGGCT
TTCGAACACGAGTCCTTTGAGGACGCTGTCGATGTTCCCGCCCATGTCGTTCCCGTCGACGTCCACACTGCTGAT
ACCGTCTCGGTTCGCTCCCTGACCAAGAGGGCTGTGGCCGTCACCCAGAGCCCGGCTTCGGACGAGTCCGACGAT
ACCGAGGCCAGTGTCGTCGACGACAAGGAAGAAGTCGAGGAAAAGGACGCAAGCGACGAGAAAGACGGAGTTGAC
AACGTCAGACACAGAAGTGACGGAGAGAAGGACGGAGTCGATGACAAGGACGACACCAACAGGGCCGCACAAAAA
CCAGTTCCCGACGCTCGAAGTGAAGTCCCCATTCCACCTCAGTCGCAGGCCAGGCCACCGTCTCGTCATCAATCA
CCCGCTCATTCCAGCCGCATTTCCAGCACCGCGAATCTCGACAATGTCAATCTGGATGACGAGGCAGCAATCAAA
CACCAAGAACCCCCGAGCCCCGTACCTAAAGAACAGCCAAGCAAGAAGCTGTCTCTCGGCAGTCTTGCTGGCGCC
CTCCCTTCTATGCCGTGGAACCCTCCGAACGACACATCCTCCAAAGGCTCTGGGCCACCGTTAACCGCCGGCACT
TCCAGTCAGCCGCCGGCACCAACCAGGAAATTGACGAGCCCTTTTTCCTGGTTATCCCGCAACACAACAAGTAAG
GATAAGGAAAGCCAACCGTCGCCTCCCGCCCAGACCTCTCCGCGGCGCAACACGGCCAGCTCAGTGGCTACCCTC
ATGAGCAATCCGGAAATGATGCTCAGCAGACTGGAGGAGGACAAAGACGGCGGTAGGCGGGGCTCGAACCGCGAG
AGCCTCAAGGACAGGTTCAAGGCTCTCCGGTTACGAGAGGAGAGCGGCATGTCGACACCCGCAGCCGACGGCGAC
AAGGCCGGCGGAGCGTTGGGCCTCGTCAACCAGGATGACGAGACCGTAGCTGGCGAGATGCCCCCTCCCTCGCCC
GTGCCCGGGCCCAACATCGGCTTGGCCCCGGGAACCATGTCGGGAATCAATGCCGGCCCCTCGGCGATGCCGGAC
ACGCGGGTCGACTGGGACCTGTGGCAATCCGTCGTCTACGAAGGCCCGGCGGCCGTGGCTCGGTCGAGTGCAGAA
GAGCTCAATAGGGCCATCGCGACGGGCATTCCCAATGCCATCCGCGGAGTCGTCTGGCAGGTCCTGGCCCAGAGC
AAGAGTGACGGCCTCGAGGTTGTCTACAGGGAACTAGTCGCTCGAGGCACGGAGAAGGACAGGGATCGGCACAGC
AATAGCACGACGACGAGCTCCATTAGCAATGCGAGCCTCAGCGCCCATAGCGGCGACGCGCCCACGTCGTCTGCG
TCGTCGGTGCATTCTGAGCAATCCGGCGCCACCGGGGAGAAGGGTTCGGACGCCGTGGTCAGGCCGACGGCCATC
TCTCCCGAGGAGCGCAAGAAGAAGACCAAGGAAAATGCGGCAGCGCTCCAGAAGCTGGAGAAGACGATCCGCCGC
GATCTCGGCGCCCGCACGAGCTACTCCAAGTACGCGGCTGCCTCGGGGCTTCAGGACGGCCTCTTTGGGGTTTGC
AAGGCGTACGCGCTGTACGACGAAGGCGTCGGCTACGCGCAGGGCATGAACTTCCTCATCATGCCGCTGCTGTTC
AACATGCCGGAGCAAGAAGCCTTTTGCCTCCTGGTGCGCTTGATGAACCAGTACCATCTGCGGGAGCTCTTCATC
CAGGATATGCCCGGGCTGCATATGCACCTGTATCAGTTCGAGCGCCTCCTCGAGGACACGGAGCCGGCGCTGTAC
TGTCACCTGCACCGGCGCGGCATCTCGTCTCACCTGTACGCGACGCAGTGGTTCCTGACGCTGTTTGCTTACCGC
TTCCCGCTGCAGCTGGTGCTGCGCATCTACGACCTGATCTTTTCAGAAGGCCTGTCGGCCATCCTGCGGTTCGGC
ATCGTGCTGATGCAGAAGAACGCAGCAACGCTGCTGGCCCTTTCGGACATGCAGCAGCTGACGACGCACCTCAAG
GACAAGCTCTTCGACGTCTACATCGACAAGGACCCGAGCCAGGGTAGCATCCTCGAGAACGGTTTCTTCGGCAGC
TCAACCGCGAGCCAGGACAAGGAGGTGTACAGGGCGGACCAGCTAGTCCGCGACGCGTGCGAGGTCAAGATCACG
CCCGAGCTTCTCAAGGCCTACACGTCCGAATGGGAGGAAAAGACGCGAGCCGAGCGCGGCCGCGAGGCAGAACTA
CAGGACCTCAGCCAGGCCAACCAGAGCTACGCCGCGCAGGTGCGCAAGCTGGAAGAGCGCGTCGAGGCCTGCGAC
CGCGAGCAGACGGCGCTGGCGACGGAGATGGTGCACACAAAGGTCGAGAACGAGGAGCTGCGGGACGAGAACGAG
AGTCTCAAGGGTCAGGTCCGCGAGCTCAAAGTCGTGATTGAGAAGCAGCCGGCCGACATTGAGGCTTCGTGGAAA
CTTGAGAGGGATGACCTCATGAAGCGCAACGGTCACGTCCACGAGGAGAATCAGCGGCTTGAAAAGGAACTTGCC
GAGCTGGAGGAGGAGCTGGTGCAGACCAAGATGCACTATGCCGAGCTTCACTCCCAGCACGAAACCCTCAACCGC
AAATGGGCAGACCTAAAGCGCCAATTCGCCTGA
Gene >Ophcf2|06564
ATGGAGGATCCCAAGCCATCACGTCCTGCAGGCGACGAGGAGTCGTTGGCTGCGGAAGCGAACCATGATACGGTA
TGACCCTCGCCACTGTCTTTGACTGGTCGCCGTCGTTGCACCGCAGCCGCGTCTCGTTATTGACAAGTCAAGGCT
TTCGAACACGAGTCCTTTGAGGACGCTGTCGATGTTCCCGCCCATGTCGTTCCCGTCGACGTCCACACTGCTGAT
ACCGTCTCGGTTCGCTCCCTGACCAAGAGGGCTGTGGCCGTCACCCAGAGCCCGGCTTCGGACGAGTCCGACGAT
ACCGAGGCCAGTGTCGTCGACGACAAGGAAGAAGTCGAGGAAAAGGACGCAAGCGACGAGAAAGACGGAGTTGAC
AACGTCAGACACAGAAGTGACGGAGAGAAGGACGGAGTCGATGACAAGGACGACACCAACAGGGCCGCACAAAAA
CCAGTTCCCGACGCTCGAAGTGAAGTCCCCATTCCACCTCAGTCGCAGGCCAGGCCACCGTCTCGTCATCAATCA
CCCGCTCATTCCAGCCGCATTTCCAGCACCGCGAATCTCGACAATGTCAATCTGGATGACGAGGCAGCAATCAAA
CACCAAGGTAGATGACCTGAGCACTCTCGTCCTAGTCCGAAGCTGACTTTCGTTCAGAACCCCCGAGCCCCGTAC
CTAAAGAACAGCCAAGCAAGAAGCTGTCTCTCGGCAGTCTTGCTGGCGCCCTCCCTTCTATGCCGTGGAACCCTC
CGAACGACACATCCTCCAAAGGCTCTGGGCCACCGTTAACCGCCGGCACTTCCAGTCAGCCGCCGGCACCAACCA
GGAAATTGACGAGCCCTTTTTCCTGGTTATCCCGCAACACAACAAGTAAGGATAAGGAAAGCCAACCGTCGCCTC
CCGCCCAGACCTCTCCGCGGCGCAACACGGCCAGCTCAGTGGCTACCCTCATGAGCAATCCGGAAATGATGCTCA
GCAGACTGGAGGAGGACAAAGACGGCGGTAGGCGGGGCTCGAACCGCGAGAGCCTCAAGGACAGGTTCAAGGCTC
TCCGGTTACGAGAGGAGAGCGGCATGTCGACACCCGCAGCCGACGGCGACAAGGCCGGCGGAGCGTTGGGCCTCG
TCAACCAGGATGACGAGACCGTAGCTGGCGAGATGCCCCCTCCCTCGCCCGTGCCCGGGCCCAACATCGGCTTGG
CCCCGGGAACCATGTCGGGAATCAATGCCGGCCCCTCGGCGATGCCGGACACGCGGGTCGACTGGGACCTGTGGC
AATCCGTCGTCTACGAAGGCCCGGCGGCCGTGGCTCGGTCGAGTGCAGAAGAGCTCAATAGGGCCATCGCGACGG
GCATTCCCAATGCCATCCGCGGAGTCGTCTGGCAGGTCCTGGCCCAGAGCAAGAGTGACGGCCTCGAGGTTGTCT
ACAGGGAACTAGTCGCTCGAGGCACGGAGAAGGACAGGGATCGGCACAGCAATAGCACGACGACGAGCTCCATTA
GCAATGCGAGCCTCAGCGCCCATAGCGGCGACGCGCCCACGTCGTCTGCGTCGTCGGTGCATTCTGAGCAATCCG
GCGCCACCGGGGAGAAGGGTTCGGACGCCGTGGTCAGGCCGACGGCCATCTCTCCCGAGGAGCGCAAGAAGAAGA
CCAAGGAAAATGCGGCAGCGCTCCAGAAGCTGGAGAAGACGATCCGCCGCGATCTCGGCGCCCGCACGAGCTACT
CCAAGTACGCGGCTGCCTCGGGGCTTCAGGACGGCCTCTTTGGGGTTTGCAAGGCGTACGCGCTGTACGACGAAG
GCGTCGGCTACGCGCAGGGCATGAACTTCCTCATCATGCCGCTGCTGTTCAACGTGGGTTGCCTATCCTCCGGGC
ATCTCACCGGGCCTGAGTTGCTGACGCGTTACACAGATGCCGGAGCAAGAAGCCTTTTGCCTCCTGGTGCGCTTG
ATGAACCAGTACCATCTGCGGGAGCTCTTCATCCAGGATATGCCCGGGCTGCATATGCACCTGTATCAGTTCGAG
CGCCTCCTCGAGGACACGGAGCCGGCGCTGTACTGTCACCTGCACCGGCGCGGCATCTCGTCTCACCTGTACGCG
ACGCAGTGGTTCCTGACGCTGTTTGCTTACCGCTTCCCGCTGCAGCTGGTGCTGCGCATCTACGACCTGATCTTT
TCAGAAGGCCTGTCGGCCATCCTGCGGTTCGGCATCGTGCTGATGCAGAAGAACGCAGCAACGCTGCTGGCCCTT
TCGGACATGCAGCAGCTGACGACGCACCTCAAGGACAAGCTCTTCGACGTCTACATCGACAAGGACCCGAGCCAG
GGTAGCATCCTCGAGAACGGTTTCTTCGGCAGCTCAACCGCGAGCCAGGACAAGGAGGTGTACAGGGCGGACCAG
CTAGTCCGCGACGCGTGCGAGGTCAAGATCACGCCCGAGCTTCTCAAGGCCTACACGTCCGAATGGGAGGAAAAG
ACGCGAGCCGAGCGCGGCCGCGAGGCAGAACTACAGGACCTCAGCCAGGCCAACCAGAGCTACGCCGCGCAGGTG
CGCAAGCTGGAAGAGCGCGTCGAGGCCTGCGACCGCGAGCAGACGGCGCTGGCGACGGAGATGGTGCACACAAAG
GTCGAGAACGAGGAGCTGCGGGACGAGAACGAGAGTCTCAAGGGTCAGGTCCGCGAGCTCAAAGTCGTGATTGAG
AAGCAGCCGGCCGACATTGAGGCTTCGTGGAAACTTGAGAGGGATGACCTCATGAAGCGCAACGGTCACGTCCAC
GAGGAGAATCAGCGGCTTGAAAAGGAACTTGCCGAGCTGGAGGAGGAGCTGGTGCAGACCAAGATGCACTATGCC
GAGGTGCGTTTTTCTCTCTCTCTCTCTCTGTCTCTCTGTCTCTCTGTCTCTCTCCCTCTCTCCCTCTCTCTGCTT
CTCTGTGTCTATCTCTGTATCTCTCCCTCTCTCTCCTTCTCTGTATCTATCTCTGTATCTCTCCCTCTCCCTCTC
TCTCCTTCTCTGTATCTCTCTCTGTCTCTCCCTCCCTCTTCTATCCTCTCCTCCTGCTGACGATCCCTCCAGCTT
CACTCCCAGCACGAAACCCTCAACCGCAAATGGGCAGACCTAAAGCGCCAATTCGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail