Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06563
Gene name
Locationscaffold_08:438560..439660
Strand+
Gene length (bp)1100
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01201 Ribosomal_S8e Ribosomal protein S8e 1.0E-32 67 207

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4748 0.3369 0.0628 0.0344 0.3435 0.0494 0.0926 0.0451 0.0226 0.0485

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5101
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2083
Ophiocordyceps australis map64 (Brazil) OphauB2|7485
Ophiocordyceps camponoti-floridani Ophcf2|06563 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4908
Ophiocordyceps kimflemingae Ophio5|817
Ophiocordyceps subramaniannii Hirsu2|3175

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06563
MSPELASQPASSKRHDSLLDCPGDRRLHQISQSWVSLATPVTSAPRPAPNAPSIGRSELSRPAARAPTRYRALRL
DSGNFAWASEGCTRKTRVIAVAYHPSNNELVRTNTLTRSAVVQVDAAPFRQWYEAHYGQALGRRRQKAQAAKEGK
VEQETKKSKSVEKKQAARFAASGKVEAPLEKQFEAGRLYAIISSRPGQSGRCDGYILEGDELAFYQRKLHK*
Coding >Ophcf2|06563
ATGAGCCCTGAGCTCGCATCGCAGCCAGCCTCGTCGAAGCGTCACGACTCTCTACTCGATTGCCCTGGTGATCGT
CGACTTCATCAGATCTCGCAATCATGGGTATCTCTCGCGACTCCCGTCACAAGCGCTCCGCGTCCGGCGCCAAAC
GCGCCTTCTATCGGAAGAAGCGAGCTTTCGAGGCCGGCCGCCAGGGCGCCAACACGCTACCGCGCCCTGCGCCTC
GACTCGGGCAATTTCGCCTGGGCCTCTGAGGGTTGCACCCGAAAGACGCGCGTCATCGCCGTCGCCTACCACCCT
TCCAACAACGAGCTCGTCCGCACCAACACCTTGACCCGCAGTGCCGTCGTCCAGGTCGACGCCGCGCCCTTCCGT
CAATGGTACGAGGCTCACTACGGCCAGGCCCTGGGCCGCAGGCGTCAGAAGGCCCAGGCCGCCAAGGAGGGAAAG
GTCGAGCAGGAGACCAAGAAGAGCAAGTCGGTTGAGAAGAAGCAGGCTGCCAGGTTCGCCGCCTCGGGCAAGGTT
GAGGCCCCGCTGGAGAAGCAATTTGAGGCCGGTCGCCTGTACGCCATCATCTCCAGCCGGCCCGGTCAGTCCGGC
CGCTGCGACGGCTACATCCTCGAGGGCGATGAGCTCGCCTTTTACCAGCGCAAGCTGCACAAGTGA
Transcript >Ophcf2|06563
ATGAGCCCTGAGCTCGCATCGCAGCCAGCCTCGTCGAAGCGTCACGACTCTCTACTCGATTGCCCTGGTGATCGT
CGACTTCATCAGATCTCGCAATCATGGGTATCTCTCGCGACTCCCGTCACAAGCGCTCCGCGTCCGGCGCCAAAC
GCGCCTTCTATCGGAAGAAGCGAGCTTTCGAGGCCGGCCGCCAGGGCGCCAACACGCTACCGCGCCCTGCGCCTC
GACTCGGGCAATTTCGCCTGGGCCTCTGAGGGTTGCACCCGAAAGACGCGCGTCATCGCCGTCGCCTACCACCCT
TCCAACAACGAGCTCGTCCGCACCAACACCTTGACCCGCAGTGCCGTCGTCCAGGTCGACGCCGCGCCCTTCCGT
CAATGGTACGAGGCTCACTACGGCCAGGCCCTGGGCCGCAGGCGTCAGAAGGCCCAGGCCGCCAAGGAGGGAAAG
GTCGAGCAGGAGACCAAGAAGAGCAAGTCGGTTGAGAAGAAGCAGGCTGCCAGGTTCGCCGCCTCGGGCAAGGTT
GAGGCCCCGCTGGAGAAGCAATTTGAGGCCGGTCGCCTGTACGCCATCATCTCCAGCCGGCCCGGTCAGTCCGGC
CGCTGCGACGGCTACATCCTCGAGGGCGATGAGCTCGCCTTTTACCAGCGCAAGCTGCACAAGTGA
Gene >Ophcf2|06563
ATGAGCCCTGAGCTCGGTACGTATCCCCAGACCCCATGCCCACAACCACAATTTTCTCCAGCATCGCAGCCAGCC
TCGTCGAAGCGTCACGACTCTCTACTCGATTGCCCTGGTGATCGTCGACTTCATCAGGTAAGCTCCCAGCGGTGC
GGCGCGTTTTCATCGACGATCACGGTGGGACTCTTCGGGAAGTGACGGACCGCAGCTACTTCCCGTACCGTTCAC
TCTTCGGGGGGTCCTCGTCCGCGAAAACTACCTGCTTCTCCTCCACTCCCTCACTCCATCAGACGAATACCATAC
TGACTTTTTCTCTCTTCCTCTATCCAGATCTCGCAATCATGGGTATCTCTCGCGACTCCCGTCACAAGCGCTCCG
CGTCCGGCGCCAAACGCGCCTTCTATCGTGCGTGACCGAACATCCGAAGCCTCTCGAAAGCCCGTATGCCATCTC
TCCTCTCTTCTTCTCTTCCCATCCCCTTTCCCCAAAGGGAGGGTCGCAGAGAAGAGAGGGGGTGAGGAGCATGCG
TTCTGACCTCATCTGCAGGGAAGAAGCGAGCTTTCGAGGCCGGCCGCCAGGGCGCCAACACGCGTATCGGCCCCA
AGCGCATCCATACAGTTCGCACCCGCGGCGGAAACCACAAGTACCGCGCCCTGCGCCTCGACTCGGGCAATTTCG
CCTGGGCCTCTGAGGGTTGCACCCGAAAGACGCGCGTCATCGCCGTCGCCTACCACCCTTCCAACAACGAGCTCG
TCCGCACCAACACCTTGACCCGCAGTGCCGTCGTCCAGGTCGACGCCGCGCCCTTCCGTCAATGGTACGAGGCTC
ACTACGGCCAGGCCCTGGGCCGCAGGCGTCAGAAGGCCCAGGCCGCCAAGGAGGGAAAGGTCGAGCAGGAGACCA
AGAAGAGCAAGTCGGTTGAGAAGAAGCAGGCTGCCAGGTTCGCCGCCTCGGGCAAGGTTGAGGCCCCGCTGGAGA
AGCAATTTGAGGCCGGTCGCCTGTACGCCATCATCTCCAGCCGGCCCGGTCAGTCCGGCCGCTGCGACGGCTACA
TCCTCGAGGGCGATGAGCTCGCCTTTTACCAGCGCAAGCTGCACAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail