Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06560
Gene name
Locationscaffold_08:432714..433689
Strand-
Gene length (bp)975
Transcript length (bp)903
Coding sequence length (bp)903
Protein length (aa) 301

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02544 Steroid_dh 3-oxo-5-alpha-steroid 4-dehydrogenase 4.7E-28 150 299

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 90 109 19
2 160 177 17
3 190 212 22
4 227 249 22
5 256 273 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06560
MATNLKLTNRSARDPVARLPTSIQVPAGATIEDAKTIIARGCGLGDGSRVGLFDPATKKTLKDRKARLTDALPDG
EVLVKDLGPQVAWRTVFLVEYLGPILIHVGFVALRPRLYSEPMSSTQWLSFAMIVGHFVKRELETLLVHKFSAST
MPLFNIFKNSFFYWGLSGLLCAWSVYNPRSMAARANTPALDALGTALFLFGETGNGLVHLYLSSLRSSGGTERKI
PAGYGFSLVTCPNYMFEILSWLGVIVASRDWAVTLFIGIGAAQMYAWARGKESAYRKEFGDKYKKKRFVMLPGLL
*
Coding >Ophcf2|06560
ATGGCCACCAATCTCAAGCTCACCAACCGCTCCGCAAGGGATCCCGTGGCCCGGCTGCCCACCTCGATTCAAGTC
CCCGCCGGGGCGACGATAGAAGATGCCAAGACAATCATCGCCCGAGGCTGCGGTCTCGGAGATGGGAGTCGAGTC
GGTCTCTTCGACCCGGCGACTAAGAAGACGCTCAAGGATCGCAAGGCGCGGCTGACGGATGCGCTGCCAGATGGC
GAGGTGCTCGTCAAGGACCTCGGGCCACAGGTAGCGTGGAGGACCGTCTTCCTGGTCGAATACCTAGGCCCGATT
CTTATTCACGTCGGGTTCGTCGCCTTGAGGCCTCGCCTTTACTCGGAACCCATGTCGTCGACGCAATGGCTCAGT
TTCGCCATGATCGTCGGCCACTTTGTCAAGCGCGAGCTCGAGACGCTCTTGGTCCACAAATTCTCCGCCAGCACC
ATGCCCCTCTTCAACATCTTCAAGAACAGCTTTTTCTACTGGGGTCTTTCCGGCCTTTTGTGCGCTTGGTCCGTC
TACAACCCGCGCTCCATGGCAGCTCGGGCCAACACGCCGGCACTCGACGCCCTCGGGACAGCTCTCTTTCTCTTC
GGCGAGACGGGCAATGGCCTGGTGCATCTGTACCTTTCATCGTTGCGTTCCAGCGGCGGCACGGAGCGTAAGATT
CCCGCCGGCTATGGCTTCAGCCTCGTCACCTGTCCCAACTACATGTTTGAGATCCTTTCGTGGCTGGGCGTCATC
GTTGCCAGCCGCGACTGGGCCGTTACGCTCTTCATCGGCATCGGAGCCGCTCAGATGTACGCCTGGGCCCGTGGC
AAGGAGAGCGCGTACCGCAAGGAGTTTGGCGATAAGTACAAGAAGAAGCGCTTCGTTATGCTTCCGGGTCTGCTG
TAA
Transcript >Ophcf2|06560
ATGGCCACCAATCTCAAGCTCACCAACCGCTCCGCAAGGGATCCCGTGGCCCGGCTGCCCACCTCGATTCAAGTC
CCCGCCGGGGCGACGATAGAAGATGCCAAGACAATCATCGCCCGAGGCTGCGGTCTCGGAGATGGGAGTCGAGTC
GGTCTCTTCGACCCGGCGACTAAGAAGACGCTCAAGGATCGCAAGGCGCGGCTGACGGATGCGCTGCCAGATGGC
GAGGTGCTCGTCAAGGACCTCGGGCCACAGGTAGCGTGGAGGACCGTCTTCCTGGTCGAATACCTAGGCCCGATT
CTTATTCACGTCGGGTTCGTCGCCTTGAGGCCTCGCCTTTACTCGGAACCCATGTCGTCGACGCAATGGCTCAGT
TTCGCCATGATCGTCGGCCACTTTGTCAAGCGCGAGCTCGAGACGCTCTTGGTCCACAAATTCTCCGCCAGCACC
ATGCCCCTCTTCAACATCTTCAAGAACAGCTTTTTCTACTGGGGTCTTTCCGGCCTTTTGTGCGCTTGGTCCGTC
TACAACCCGCGCTCCATGGCAGCTCGGGCCAACACGCCGGCACTCGACGCCCTCGGGACAGCTCTCTTTCTCTTC
GGCGAGACGGGCAATGGCCTGGTGCATCTGTACCTTTCATCGTTGCGTTCCAGCGGCGGCACGGAGCGTAAGATT
CCCGCCGGCTATGGCTTCAGCCTCGTCACCTGTCCCAACTACATGTTTGAGATCCTTTCGTGGCTGGGCGTCATC
GTTGCCAGCCGCGACTGGGCCGTTACGCTCTTCATCGGCATCGGAGCCGCTCAGATGTACGCCTGGGCCCGTGGC
AAGGAGAGCGCGTACCGCAAGGAGTTTGGCGATAAGTACAAGAAGAAGCGCTTCGTTATGCTTCCGGGTCTGCTG
TAA
Gene >Ophcf2|06560
ATGGCCACCAATCTCAAGCTCACCAACCGCTGTAACCCTTCCCCCCCCCCCCCCAAATCTCTGCCCAGCCCACCT
CCTCTCAGCTAACAAACCTACCATCAAGCCGCAAGGGATCCCGTGGCCCGGCTGCCCACCTCGATTCAAGTCCCC
GCCGGGGCGACGATAGAAGATGCCAAGACAATCATCGCCCGAGGCTGCGGTCTCGGAGATGGGAGTCGAGTCGGT
CTCTTCGACCCGGCGACTAAGAAGACGCTCAAGGATCGCAAGGCGCGGCTGACGGATGCGCTGCCAGATGGCGAG
GTGCTCGTCAAGGACCTCGGGCCACAGGTAGCGTGGAGGACCGTCTTCCTGGTCGAATACCTAGGCCCGATTCTT
ATTCACGTCGGGTTCGTCGCCTTGAGGCCTCGCCTTTACTCGGAACCCATGTCGTCGACGCAATGGCTCAGTTTC
GCCATGATCGTCGGCCACTTTGTCAAGCGCGAGCTCGAGACGCTCTTGGTCCACAAATTCTCCGCCAGCACCATG
CCCCTCTTCAACATCTTCAAGAACAGCTTTTTCTACTGGGGTCTTTCCGGCCTTTTGTGCGCTTGGTCCGTCTAC
AACCCGCGCTCCATGGCAGCTCGGGCCAACACGCCGGCACTCGACGCCCTCGGGACAGCTCTCTTTCTCTTCGGC
GAGACGGGCAATGGCCTGGTGCATCTGTACCTTTCATCGTTGCGTTCCAGCGGCGGCACGGAGCGTAAGATTCCC
GCCGGCTATGGCTTCAGCCTCGTCACCTGTCCCAACTACATGTTTGAGATCCTTTCGTGGCTGGGCGTCATCGTT
GCCAGCCGCGACTGGGCCGTTACGCTCTTCATCGGCATCGGAGCCGCTCAGATGTACGCCTGGGCCCGTGGCAAG
GAGAGCGCGTACCGCAAGGAGTTTGGCGATAAGTACAAGAAGAAGCGCTTCGTTATGCTTCCGGGTCTGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail