Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06557
Gene name
Locationscaffold_08:424898..425654
Strand-
Gene length (bp)756
Transcript length (bp)573
Coding sequence length (bp)573
Protein length (aa) 191

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03248 Rer1 Rer1 family 9.7E-78 17 186

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 59 81 22
3 141 163 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 230.70 132.58 328.82
Alive In ants, during behavior modification 370.01 201.89 538.12
Dead In ants, recently dead 219.92 126.00 313.84

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.010258 yes
Alive Dead 0.001226 yes
Dead Fungus 0.839818 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06557
MDASESEQTAFASVTAQTSKLQRHYQAVLDRSTPFVLYRWFGTGVLLIFFFLRILFAQGWYIVAYALGIYLLNLF
LAFLQPKFDPSNDALDNEMEDGAVGTLPTKQDEEFKPFIRRLPEFKFWYWATRAVVISFTCTFFELFNVPVFWPV
LVMYWIILFVLTMRKQIQHMVKYRYVPFTIGKKNYNKNSP*
Coding >Ophcf2|06557
ATGGACGCGTCCGAGTCGGAACAGACGGCCTTTGCCAGCGTTACGGCGCAGACGTCCAAGCTCCAGAGGCATTAC
CAGGCGGTCCTGGACCGGTCCACGCCCTTTGTGCTGTACCGATGGTTCGGCACGGGCGTCTTGTTGATCTTCTTC
TTTCTGCGTATTCTCTTCGCGCAGGGGTGGTATATCGTGGCCTATGCCCTCGGCATCTACCTCCTCAACCTTTTC
CTCGCCTTCCTGCAGCCCAAGTTCGACCCGTCGAATGACGCGCTCGATAACGAGATGGAGGATGGGGCGGTCGGG
ACGCTGCCGACGAAGCAAGACGAAGAGTTCAAGCCCTTTATCCGCCGTCTGCCCGAGTTCAAATTCTGGTACTGG
GCTACGCGCGCCGTCGTCATCTCCTTTACCTGCACCTTCTTCGAACTCTTCAACGTGCCCGTCTTCTGGCCCGTT
CTCGTCATGTACTGGATCATCCTCTTCGTCTTGACCATGCGCAAGCAGATCCAACACATGGTCAAATACCGCTAC
GTGCCCTTCACCATCGGCAAGAAGAACTACAACAAGAACAGCCCCTAA
Transcript >Ophcf2|06557
ATGGACGCGTCCGAGTCGGAACAGACGGCCTTTGCCAGCGTTACGGCGCAGACGTCCAAGCTCCAGAGGCATTAC
CAGGCGGTCCTGGACCGGTCCACGCCCTTTGTGCTGTACCGATGGTTCGGCACGGGCGTCTTGTTGATCTTCTTC
TTTCTGCGTATTCTCTTCGCGCAGGGGTGGTATATCGTGGCCTATGCCCTCGGCATCTACCTCCTCAACCTTTTC
CTCGCCTTCCTGCAGCCCAAGTTCGACCCGTCGAATGACGCGCTCGATAACGAGATGGAGGATGGGGCGGTCGGG
ACGCTGCCGACGAAGCAAGACGAAGAGTTCAAGCCCTTTATCCGCCGTCTGCCCGAGTTCAAATTCTGGTACTGG
GCTACGCGCGCCGTCGTCATCTCCTTTACCTGCACCTTCTTCGAACTCTTCAACGTGCCCGTCTTCTGGCCCGTT
CTCGTCATGTACTGGATCATCCTCTTCGTCTTGACCATGCGCAAGCAGATCCAACACATGGTCAAATACCGCTAC
GTGCCCTTCACCATCGGCAAGAAGAACTACAACAAGAACAGCCCCTAA
Gene >Ophcf2|06557
ATGGACGCGTCCGAGTCGGAACAGACGGCCTTTGCCAGCGTTACGGCGCAGACGTCCAAGCTCCAGAGGGTACGA
CGAACGATGATGGTGGTCGGGAGCCCGGCTTTCGGCCTGTGCTGACGGCAACGATGCAGCATTACCAGGCGGTCC
TGGACCGGTCCACGCCCTTTGTGCTGTACCGATGGTTCGGCACGGGCGTCTTGTTGATCTTCTTCTTTCTGCGTA
TTCTCTTCGCGCAGGGGTGGTATATCGGTGCGTGTTTCTTCCCAGGTATTCGAGCAGCACCGATGCCGCTGACGA
CGTGAGCCAAGTGGCCTATGCCCTCGGCATCTACCTCCTCAACCTTTTCCTCGCCTTCCTGCAGCCCAAGTTCGA
CCCGTCGAATGACGCGCTCGATAACGAGATGGAGGATGGGGCGGTCGGGACGCTGCCGACGAAGCAAGACGAAGA
GTTCAAGCCCTTTATCCGCCGTCTGCCCGAGTTCAAATTCTGGTACTGGGCTACGCGCGCCGTCGTCATCTCCTT
TACCTGCACCTTCTTCGAACTCTTCAACGTGCCCGTCTTCTGGCCCGTTCTCGTCATGTACTGGATCATCCTCTT
CGTCTTGACCAGTACGTGTTTCCTCCCCCGGTCTTCGCCAGCTGATGAAGGCTGACTCGCTCCTCGGCAGTGCGC
AAGCAGATCCAACACATGGTCAAATACCGCTACGTGCCCTTCACCATCGGCAAGAAGAACTACAACAAGAACAGC
CCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail