Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06556
Gene name
Locationscaffold_08:423566..424239
Strand+
Gene length (bp)673
Transcript length (bp)459
Coding sequence length (bp)459
Protein length (aa) 153

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1077 0.0423 0.9496 0.0628 0.0814 0.0151 0.1599 0.1846 0.099 0.0029

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999763

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 26.66 8.69 44.63
Alive In ants, during behavior modification 9.19 0.57 17.82
Dead In ants, recently dead 9.03 1.25 16.81

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.004680 yes
Alive Dead 0.969390 no
Dead Fungus 0.001226 yes

Orthologs

Orthofinder run ID4
Orthogroup7076
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06556 (this protein)
Ophiocordyceps kimflemingae Ophio5|809
Ophiocordyceps subramaniannii Hirsu2|6005

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06556
MLPRVLVGLAGLVAFAVAEPATIGNMTEVMSDEEIEIACDSPNKPNPLRPNYLGIFYSLTEYRGDNLTFGFEDKK
RCVNLEPPFIEPGKNNHPSRSIRIGCATKDHCTMFQHFNCKGSQRTYGKNKGNVKAHRGIKSIRCKQWHNPSSSG
DS*
Coding >Ophcf2|06556
ATGTTGCCCAGGGTGCTAGTCGGGTTGGCTGGTTTGGTGGCCTTTGCGGTTGCTGAACCTGCGACGATAGGGAAT
ATGACGGAGGTCATGTCGGATGAGGAGATTGAGATTGCGTGTGACAGTCCGAATAAGCCGAATCCTTTGCGGCCA
AATTACTTGGGCATCTTCTACAGTCTGACTGAATACCGTGGCGATAACCTCACCTTCGGCTTCGAAGATAAGAAG
CGTTGCGTCAACCTCGAGCCTCCCTTCATCGAGCCCGGGAAGAACAACCACCCTTCGCGCTCAATCCGCATCGGC
TGCGCTACCAAAGACCACTGCACAATGTTCCAACATTTTAACTGCAAGGGGTCGCAGCGCACCTACGGGAAGAAC
AAGGGGAACGTCAAGGCCCATCGCGGCATCAAGTCTATCCGCTGCAAGCAGTGGCATAACCCGAGTTCGTCGGGG
GATAGCTAG
Transcript >Ophcf2|06556
ATGTTGCCCAGGGTGCTAGTCGGGTTGGCTGGTTTGGTGGCCTTTGCGGTTGCTGAACCTGCGACGATAGGGAAT
ATGACGGAGGTCATGTCGGATGAGGAGATTGAGATTGCGTGTGACAGTCCGAATAAGCCGAATCCTTTGCGGCCA
AATTACTTGGGCATCTTCTACAGTCTGACTGAATACCGTGGCGATAACCTCACCTTCGGCTTCGAAGATAAGAAG
CGTTGCGTCAACCTCGAGCCTCCCTTCATCGAGCCCGGGAAGAACAACCACCCTTCGCGCTCAATCCGCATCGGC
TGCGCTACCAAAGACCACTGCACAATGTTCCAACATTTTAACTGCAAGGGGTCGCAGCGCACCTACGGGAAGAAC
AAGGGGAACGTCAAGGCCCATCGCGGCATCAAGTCTATCCGCTGCAAGCAGTGGCATAACCCGAGTTCGTCGGGG
GATAGCTAG
Gene >Ophcf2|06556
ATGTTGCCCAGGGTGCTAGTCGGGTTGGCTGGTTTGGTGGCCTTTGCGGTTGCTGAACCTGCGACGATAGGGAAT
ATGACGGAGGTCATGTCGGATGAGGAGATTGAGATTGCGTGTGACAGTCCGAATAAGCCGAATCCTTTGCGGCCA
AATTACTTGGTATGTCGACCTTGTTTTTTACGTCTCGTTCTTGTTACTCATGCTCGGTTGGATAGGGCATCTTCT
ACAGTCTGACTGAATACCGTGGCGATAACCTCACCTTCGGCTTCGAAGATAAGAAGCGTTGCGTCAACCTCGAGC
CTCCCTTGTACGCCTCCCGTCCCGCTGAGATTATTGACCGCGCTGAACGGTGGGCAGCATCGAGCCCGGGAAGAA
CAACCACCCTTCGCGCTCAATCCGCATCGGCTGCGCTACCAAAGACCACTGCACAATGTTCCAGTTACGTCTCAT
CATACCTGTCTTCTTCTCGGCCTTGCGCTGACGCGGGATTCCCAGACATTTTAACTGCAAGGGGTCGCAGCGCAC
CTACGGGAAGAACAAGGGGAACGTCAAGGCCCATCGCGGCATCAAGTCTATCCGCTGCAAGCAGTGGCATAACCC
GAGGTGAGTGTTTTTCTTTTCCGTTGGATGACGAGGAGGGCTGACGGGGAGAAGTTCGTCGGGGGATAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail