Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06555
Gene name
Locationscaffold_08:420871..423083
Strand+
Gene length (bp)2212
Transcript length (bp)1824
Coding sequence length (bp)1824
Protein length (aa) 608

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 2.2E-52 22 452

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0006812 cation transport Yes
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0015298 solute:cation antiporter activity No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0015291 secondary active transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0015297 antiporter activity No
GO:0003674 molecular_function No
GO:0006811 ion transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 45 64 19
3 121 143 22
4 148 170 22
5 197 219 22
6 229 251 22
7 271 290 19
8 324 343 19
9 355 377 22
10 387 409 22
11 434 456 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 21.12 10.87 31.37
Alive In ants, during behavior modification 5.38 1.72 9.05
Dead In ants, recently dead 6.40 2.34 10.46

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.531190 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06555
MTQKKVWAIPLELSNYNVIVALLGGFISLFGLVSFLLKENFYLSESLISLLAGLAFGPLGANLIRPGAYVQCDDT
AIPDVRCEASLNHITLNFSRLVLAIQLVLAGVQLPRKYLWKEYKPILLLIGPGMTCMWLATSLLVWGLADTPGIL
QALAIGACVTPTDPVLSAVIIKGKFANENVPKDLQDLVVAESGANDGLGYPFLFLALYLIKFLGPTASSGGAREA
MGLWFAMTWSYTILLSIIFGAVVGYLAKELLRWAKERGYVDREAFTVFSIALALFVFGTCGLIGTDDLLACFIAG
NAFTWDDWFRVQTLDDSLQPTMDMLLNVSIFLWYGASLPWNLFSQNSVISTGRLVALGLLVLLLRRLPWIYCLHW
WIPQLRNAKRAVFVGFFGPMGVSAVFYLLISLNFIDDHLSDETGQPRSDVKNFGETMRVVVWFLVVCSTLVHGLS
IPLGRVGYVAPKRIMHVFKRRSSDEPLRVEARSKIPVIGRYISRSASVTVDAWRPWTALELRVLRPVHWGPDRST
RTVDGSTAGSGSATPIGKNNFVVVDLAARAKSVFSVQPATNSEKGNSAAINLPTGAGLNHYGASQANISATSLNV
SVIQLPN*
Coding >Ophcf2|06555
ATGACGCAAAAAAAGGTTTGGGCGATTCCGCTCGAGTTATCCAATTACAACGTCATCGTCGCCCTGCTTGGTGGC
TTCATCTCATTGTTCGGATTGGTATCTTTTCTATTAAAGGAGAATTTCTATCTTTCCGAGTCTCTCATCTCTCTC
CTGGCGGGTCTCGCCTTCGGGCCGCTGGGCGCAAACTTGATTCGTCCTGGAGCCTATGTTCAGTGCGATGACACG
GCCATCCCGGACGTCAGGTGCGAGGCCAGCCTCAACCACATCACCCTCAACTTCTCTCGCCTTGTTCTCGCCATT
CAGCTTGTTCTGGCGGGAGTTCAGCTGCCTAGGAAATACCTGTGGAAAGAATACAAGCCCATCTTGTTGCTCATC
GGTCCTGGAATGACGTGCATGTGGCTCGCTACGAGCCTGCTGGTCTGGGGCCTTGCAGATACACCTGGCATTCTA
CAGGCCTTGGCTATCGGTGCCTGCGTCACGCCAACGGACCCTGTCCTCTCGGCTGTGATCATCAAGGGCAAGTTT
GCCAACGAGAATGTCCCCAAGGACCTTCAGGATCTAGTCGTCGCGGAGTCTGGGGCAAACGACGGGCTCGGCTAC
CCGTTCTTGTTTCTTGCCCTGTATCTCATCAAGTTCCTCGGCCCGACAGCCTCATCTGGCGGCGCTAGAGAGGCC
ATGGGCCTCTGGTTCGCCATGACGTGGTCGTATACGATTCTACTAAGCATAATCTTTGGCGCCGTGGTGGGTTAT
CTAGCCAAGGAGCTGCTCCGTTGGGCCAAAGAACGGGGTTACGTCGACCGCGAAGCCTTTACCGTCTTCTCTATA
GCCCTCGCTCTCTTCGTCTTTGGGACATGCGGCTTGATCGGCACCGACGATCTTCTCGCCTGCTTCATCGCCGGC
AATGCCTTTACGTGGGACGACTGGTTTCGGGTACAGACGCTGGACGACTCTCTTCAGCCGACGATGGATATGCTG
CTCAACGTATCCATCTTTCTCTGGTACGGGGCGTCGCTCCCCTGGAACCTGTTTAGCCAAAACTCGGTCATTTCC
ACCGGCCGTCTCGTCGCTCTCGGCCTGCTCGTGCTGCTTCTTCGACGGCTTCCGTGGATCTACTGCTTACACTGG
TGGATTCCCCAGCTTCGGAACGCCAAAAGGGCCGTCTTTGTCGGCTTTTTTGGTCCTATGGGCGTCTCGGCCGTC
TTTTACCTACTCATCTCTCTGAACTTCATCGACGATCATCTGAGCGATGAGACGGGACAGCCTAGGAGTGACGTG
AAGAATTTTGGCGAAACCATGCGTGTTGTCGTTTGGTTTCTCGTCGTCTGTAGTACGTTGGTCCACGGACTTAGC
ATCCCGCTCGGGAGAGTGGGATACGTGGCTCCCAAGAGGATTATGCACGTTTTCAAGCGGAGGTCAAGCGATGAG
CCGCTGAGGGTCGAGGCTCGAAGTAAGATACCCGTCATTGGGAGATACATAAGCAGAAGCGCGAGTGTCACGGTC
GATGCCTGGCGTCCCTGGACGGCGTTGGAGCTTCGCGTGTTGCGCCCGGTTCATTGGGGACCTGATCGCTCGACT
CGGACGGTTGACGGCTCTACGGCTGGGTCGGGGTCTGCGACGCCAATTGGAAAGAATAACTTCGTTGTCGTTGAT
CTGGCCGCTAGAGCCAAAAGCGTCTTCAGCGTTCAGCCGGCCACGAACAGCGAGAAGGGGAACAGTGCTGCTATC
AATCTCCCTACAGGAGCTGGACTCAACCATTATGGTGCTAGCCAGGCGAATATTTCCGCAACGAGCCTCAACGTC
TCCGTTATTCAACTACCTAATTGA
Transcript >Ophcf2|06555
ATGACGCAAAAAAAGGTTTGGGCGATTCCGCTCGAGTTATCCAATTACAACGTCATCGTCGCCCTGCTTGGTGGC
TTCATCTCATTGTTCGGATTGGTATCTTTTCTATTAAAGGAGAATTTCTATCTTTCCGAGTCTCTCATCTCTCTC
CTGGCGGGTCTCGCCTTCGGGCCGCTGGGCGCAAACTTGATTCGTCCTGGAGCCTATGTTCAGTGCGATGACACG
GCCATCCCGGACGTCAGGTGCGAGGCCAGCCTCAACCACATCACCCTCAACTTCTCTCGCCTTGTTCTCGCCATT
CAGCTTGTTCTGGCGGGAGTTCAGCTGCCTAGGAAATACCTGTGGAAAGAATACAAGCCCATCTTGTTGCTCATC
GGTCCTGGAATGACGTGCATGTGGCTCGCTACGAGCCTGCTGGTCTGGGGCCTTGCAGATACACCTGGCATTCTA
CAGGCCTTGGCTATCGGTGCCTGCGTCACGCCAACGGACCCTGTCCTCTCGGCTGTGATCATCAAGGGCAAGTTT
GCCAACGAGAATGTCCCCAAGGACCTTCAGGATCTAGTCGTCGCGGAGTCTGGGGCAAACGACGGGCTCGGCTAC
CCGTTCTTGTTTCTTGCCCTGTATCTCATCAAGTTCCTCGGCCCGACAGCCTCATCTGGCGGCGCTAGAGAGGCC
ATGGGCCTCTGGTTCGCCATGACGTGGTCGTATACGATTCTACTAAGCATAATCTTTGGCGCCGTGGTGGGTTAT
CTAGCCAAGGAGCTGCTCCGTTGGGCCAAAGAACGGGGTTACGTCGACCGCGAAGCCTTTACCGTCTTCTCTATA
GCCCTCGCTCTCTTCGTCTTTGGGACATGCGGCTTGATCGGCACCGACGATCTTCTCGCCTGCTTCATCGCCGGC
AATGCCTTTACGTGGGACGACTGGTTTCGGGTACAGACGCTGGACGACTCTCTTCAGCCGACGATGGATATGCTG
CTCAACGTATCCATCTTTCTCTGGTACGGGGCGTCGCTCCCCTGGAACCTGTTTAGCCAAAACTCGGTCATTTCC
ACCGGCCGTCTCGTCGCTCTCGGCCTGCTCGTGCTGCTTCTTCGACGGCTTCCGTGGATCTACTGCTTACACTGG
TGGATTCCCCAGCTTCGGAACGCCAAAAGGGCCGTCTTTGTCGGCTTTTTTGGTCCTATGGGCGTCTCGGCCGTC
TTTTACCTACTCATCTCTCTGAACTTCATCGACGATCATCTGAGCGATGAGACGGGACAGCCTAGGAGTGACGTG
AAGAATTTTGGCGAAACCATGCGTGTTGTCGTTTGGTTTCTCGTCGTCTGTAGTACGTTGGTCCACGGACTTAGC
ATCCCGCTCGGGAGAGTGGGATACGTGGCTCCCAAGAGGATTATGCACGTTTTCAAGCGGAGGTCAAGCGATGAG
CCGCTGAGGGTCGAGGCTCGAAGTAAGATACCCGTCATTGGGAGATACATAAGCAGAAGCGCGAGTGTCACGGTC
GATGCCTGGCGTCCCTGGACGGCGTTGGAGCTTCGCGTGTTGCGCCCGGTTCATTGGGGACCTGATCGCTCGACT
CGGACGGTTGACGGCTCTACGGCTGGGTCGGGGTCTGCGACGCCAATTGGAAAGAATAACTTCGTTGTCGTTGAT
CTGGCCGCTAGAGCCAAAAGCGTCTTCAGCGTTCAGCCGGCCACGAACAGCGAGAAGGGGAACAGTGCTGCTATC
AATCTCCCTACAGGAGCTGGACTCAACCATTATGGTGCTAGCCAGGCGAATATTTCCGCAACGAGCCTCAACGTC
TCCGTTATTCAACTACCTAATTGA
Gene >Ophcf2|06555
ATGACGCAAAAAAAGGTTTGGGCGATTCCGCTCGAGTTATCCAATTACAACGTCATCGTCGCCCTGCTTGGTGGC
TTCATCTCATTGTTCGGATTGGTATCTTTTCTATTAAAGGAGAATTTCTATCTTTCCGAGTCTCGTAAGTCTTCA
ATGTCTCGATGCAACGTCGGCGTTCAATCACCTCCTACCTATTGTGAGTGACATGGTTGCTGACCTCTGCGTCGC
AGTCATCTCTCTCCTGGCGGGTCTCGCCTTCGGGCCGCTGGGCGCAAACTTGATTCGTCCTGGAGCCTATGTTCA
GTGCGATGACACGGCCATCCCGGACGTCAGGTGCGAGGCCAGCCTCAACCACATCACCCTCAACTTCTCTCGCCT
TGTTCTCGCCATTCAGCTTGTTCTGGCGGGAGTTCAGCTGCCTAGGAAATACCTGTGGAAAGAATACAAGCCCAT
CTTGTTGCTCATCGGTCCTGGAATGACGTGCATGTGGCTCGCTACGAGCCTGCTGGTCTGGGGCCTTGCAGATAC
ACCTGGCATTCTACAGGCCTTGGCTATCGGTGCCTGCGTCACGCCAACGGACCCTGTCCTCTCGGCTGTGATCAT
CAAGGGCAAGTTTGCCAACGAGAATGTCCCCAAGGACCTTCAGGATCTAGTCGTCGCGGAGTCTGGGGCAAACGA
CGGGCTCGGCTACCCGTTCTTGTTTCTTGCCCTGTATCTCATCAAGTTCCTCGGCCCGACAGCCTCATCTGGCGG
CGCTAGAGAGGCCATGGGCCTCTGGTTCGCCATGACGTGGTCGTATACGATTCTACTAAGCATAATCTTTGGCGC
CGTGGTGGGTTATCTAGCCAAGGAGCTGCTCCGTTGGGCCAAAGAACGGGGTTACGTCGACCGCGAAGCCTTTAC
CGTCTTCTCTATAGCCCTCGCTCTCTTCGTCTTTGGGACATGCGGCTTGATCGGCACCGACGATCTTCTCGCCTG
CTTCATCGCCGGCAATGCCTTTACGTGGGACGACTGGTTTCGGGTACAGACGCTGGACGACTCTCTTCAGCCGAC
GATGGATATGCTGCTCAACGTATCCATCTTTCTCTGGTACGGGGCGTCGCTCCCCTGGAACCTGTTTAGCCAAAA
CTCGGTCATTTCCACCGGCCGTCTCGTCGCTCTCGGCCTGCTCGTGCTGCTTCTTCGACGGCTTCCGTGGATCTA
CTGCTTACACTGGTGGATTCCCCAGCTTCGGAACGCCAAAAGGGCCGTCTTTGTCGGCTTTTTTGGTCCTATGGG
CGTCTCGGCCGTCTTTTACCTACTCATCTCTCTGAACTTCATCGACGATCATCTGAGCGATGAGACGGGACAGCC
TAGGAGTGACGTGAAGAATTTTGGCGAAACCATGCGTGTTGTCGTTTGGTTTCTCGTCGTCTGTAGTACGGTGAG
TGATTTCCTTCGGGTGGTCTTCCCCCCTTTTTCACTAATTGCGACGCTGTTTTAACATTTGACCGTGATAGTTGG
TCCACGGACTTAGCATCCCGCTCGGGAGAGTGGGATACGTGGCTCCCAAGAGGATTATGCACGTTTTCAAGCGGA
GGTCAAGCGATGAGCCGCTGAGGGTCGAGGCTCGAAGTAAGATACCCGTCATTGGGAGATACATAAGCAGAAGCG
CGAGTGTCACGGTCGATGCCTGGCGTCCCTGGACGGCGTTGGAGCTTCGCGTGTTGCGCCCGGTTCATTGGGGAC
CTGATCGCTCGACTCGGACGGTTGACGGCTCTACGGCTGGGTCGGGGTCTGCGACGCCAGTTTGGCGACGGAGTG
GAAGTAGGGCTTCTGATGAGACTCGGGTGGGAGGTGGTGATAGAATGGTACGGAGGGAAGGTGATGAATGATGAT
GAAAATGAAGGATGATGAGGAGGAAAAGGTAAATGAAATGGATGACTGAATGACGAGCGAGGGTTGACCTGAGAG
ATTGGAAAGGTATGTAACGACAAAGACGCACGTTGCGTGTGGACATTCAACTTACAGCATGGCTTAGAATAACTT
CGTTGTCGTTGATCTGGCCGCTAGAGCCAAAAGCGTCTTCAGCGTTCAGCCGGCCACGAACAGCGAGAAGGGGAA
CAGTGCTGCTATCAATCTCCCTACAGGAGCTGGACTCAACCATTATGGTGCTAGCCAGGCGAATATTTCCGCAAC
GAGCCTCAACGTCTCCGTTATTCAACTACCTAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail