Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06555
Gene name
Locationscaffold_08:420871..423083
Strand+
Gene length (bp)2212
Transcript length (bp)1824
Coding sequence length (bp)1824
Protein length (aa) 608

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 2.2E-52 22 452

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0006812 cation transport Yes
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0015298 solute:cation antiporter activity No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0015291 secondary active transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0015297 antiporter activity No
GO:0003674 molecular_function No
GO:0006811 ion transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 45 64 19
3 121 143 22
4 148 170 22
5 197 219 22
6 229 251 22
7 271 290 19
8 324 343 19
9 355 377 22
10 387 409 22
11 434 456 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06555
MTQKKVWAIPLELSNYNVIVALLGGFISLFGLVSFLLKENFYLSESLISLLAGLAFGPLGANLIRPGAYVQCDDT
AIPDVRCEASLNHITLNFSRLVLAIQLVLAGVQLPRKYLWKEYKPILLLIGPGMTCMWLATSLLVWGLADTPGIL
QALAIGACVTPTDPVLSAVIIKGKFANENVPKDLQDLVVAESGANDGLGYPFLFLALYLIKFLGPTASSGGAREA
MGLWFAMTWSYTILLSIIFGAVVGYLAKELLRWAKERGYVDREAFTVFSIALALFVFGTCGLIGTDDLLACFIAG
NAFTWDDWFRVQTLDDSLQPTMDMLLNVSIFLWYGASLPWNLFSQNSVISTGRLVALGLLVLLLRRLPWIYCLHW
WIPQLRNAKRAVFVGFFGPMGVSAVFYLLISLNFIDDHLSDETGQPRSDVKNFGETMRVVVWFLVVCSTLVHGLS
IPLGRVGYVAPKRIMHVFKRRSSDEPLRVEARSKIPVIGRYISRSASVTVDAWRPWTALELRVLRPVHWGPDRST
RTVDGSTAGSGSATPIGKNNFVVVDLAARAKSVFSVQPATNSEKGNSAAINLPTGAGLNHYGASQANISATSLNV
SVIQLPN*
Coding >Ophcf2|06555
ATGACGCAAAAAAAGGTTTGGGCGATTCCGCTCGAGTTATCCAATTACAACGTCATCGTCGCCCTGCTTGGTGGC
TTCATCTCATTGTTCGGATTGGTATCTTTTCTATTAAAGGAGAATTTCTATCTTTCCGAGTCTCTCATCTCTCTC
CTGGCGGGTCTCGCCTTCGGGCCGCTGGGCGCAAACTTGATTCGTCCTGGAGCCTATGTTCAGTGCGATGACACG
GCCATCCCGGACGTCAGGTGCGAGGCCAGCCTCAACCACATCACCCTCAACTTCTCTCGCCTTGTTCTCGCCATT
CAGCTTGTTCTGGCGGGAGTTCAGCTGCCTAGGAAATACCTGTGGAAAGAATACAAGCCCATCTTGTTGCTCATC
GGTCCTGGAATGACGTGCATGTGGCTCGCTACGAGCCTGCTGGTCTGGGGCCTTGCAGATACACCTGGCATTCTA
CAGGCCTTGGCTATCGGTGCCTGCGTCACGCCAACGGACCCTGTCCTCTCGGCTGTGATCATCAAGGGCAAGTTT
GCCAACGAGAATGTCCCCAAGGACCTTCAGGATCTAGTCGTCGCGGAGTCTGGGGCAAACGACGGGCTCGGCTAC
CCGTTCTTGTTTCTTGCCCTGTATCTCATCAAGTTCCTCGGCCCGACAGCCTCATCTGGCGGCGCTAGAGAGGCC
ATGGGCCTCTGGTTCGCCATGACGTGGTCGTATACGATTCTACTAAGCATAATCTTTGGCGCCGTGGTGGGTTAT
CTAGCCAAGGAGCTGCTCCGTTGGGCCAAAGAACGGGGTTACGTCGACCGCGAAGCCTTTACCGTCTTCTCTATA
GCCCTCGCTCTCTTCGTCTTTGGGACATGCGGCTTGATCGGCACCGACGATCTTCTCGCCTGCTTCATCGCCGGC
AATGCCTTTACGTGGGACGACTGGTTTCGGGTACAGACGCTGGACGACTCTCTTCAGCCGACGATGGATATGCTG
CTCAACGTATCCATCTTTCTCTGGTACGGGGCGTCGCTCCCCTGGAACCTGTTTAGCCAAAACTCGGTCATTTCC
ACCGGCCGTCTCGTCGCTCTCGGCCTGCTCGTGCTGCTTCTTCGACGGCTTCCGTGGATCTACTGCTTACACTGG
TGGATTCCCCAGCTTCGGAACGCCAAAAGGGCCGTCTTTGTCGGCTTTTTTGGTCCTATGGGCGTCTCGGCCGTC
TTTTACCTACTCATCTCTCTGAACTTCATCGACGATCATCTGAGCGATGAGACGGGACAGCCTAGGAGTGACGTG
AAGAATTTTGGCGAAACCATGCGTGTTGTCGTTTGGTTTCTCGTCGTCTGTAGTACGTTGGTCCACGGACTTAGC
ATCCCGCTCGGGAGAGTGGGATACGTGGCTCCCAAGAGGATTATGCACGTTTTCAAGCGGAGGTCAAGCGATGAG
CCGCTGAGGGTCGAGGCTCGAAGTAAGATACCCGTCATTGGGAGATACATAAGCAGAAGCGCGAGTGTCACGGTC
GATGCCTGGCGTCCCTGGACGGCGTTGGAGCTTCGCGTGTTGCGCCCGGTTCATTGGGGACCTGATCGCTCGACT
CGGACGGTTGACGGCTCTACGGCTGGGTCGGGGTCTGCGACGCCAATTGGAAAGAATAACTTCGTTGTCGTTGAT
CTGGCCGCTAGAGCCAAAAGCGTCTTCAGCGTTCAGCCGGCCACGAACAGCGAGAAGGGGAACAGTGCTGCTATC
AATCTCCCTACAGGAGCTGGACTCAACCATTATGGTGCTAGCCAGGCGAATATTTCCGCAACGAGCCTCAACGTC
TCCGTTATTCAACTACCTAATTGA
Transcript >Ophcf2|06555
ATGACGCAAAAAAAGGTTTGGGCGATTCCGCTCGAGTTATCCAATTACAACGTCATCGTCGCCCTGCTTGGTGGC
TTCATCTCATTGTTCGGATTGGTATCTTTTCTATTAAAGGAGAATTTCTATCTTTCCGAGTCTCTCATCTCTCTC
CTGGCGGGTCTCGCCTTCGGGCCGCTGGGCGCAAACTTGATTCGTCCTGGAGCCTATGTTCAGTGCGATGACACG
GCCATCCCGGACGTCAGGTGCGAGGCCAGCCTCAACCACATCACCCTCAACTTCTCTCGCCTTGTTCTCGCCATT
CAGCTTGTTCTGGCGGGAGTTCAGCTGCCTAGGAAATACCTGTGGAAAGAATACAAGCCCATCTTGTTGCTCATC
GGTCCTGGAATGACGTGCATGTGGCTCGCTACGAGCCTGCTGGTCTGGGGCCTTGCAGATACACCTGGCATTCTA
CAGGCCTTGGCTATCGGTGCCTGCGTCACGCCAACGGACCCTGTCCTCTCGGCTGTGATCATCAAGGGCAAGTTT
GCCAACGAGAATGTCCCCAAGGACCTTCAGGATCTAGTCGTCGCGGAGTCTGGGGCAAACGACGGGCTCGGCTAC
CCGTTCTTGTTTCTTGCCCTGTATCTCATCAAGTTCCTCGGCCCGACAGCCTCATCTGGCGGCGCTAGAGAGGCC
ATGGGCCTCTGGTTCGCCATGACGTGGTCGTATACGATTCTACTAAGCATAATCTTTGGCGCCGTGGTGGGTTAT
CTAGCCAAGGAGCTGCTCCGTTGGGCCAAAGAACGGGGTTACGTCGACCGCGAAGCCTTTACCGTCTTCTCTATA
GCCCTCGCTCTCTTCGTCTTTGGGACATGCGGCTTGATCGGCACCGACGATCTTCTCGCCTGCTTCATCGCCGGC
AATGCCTTTACGTGGGACGACTGGTTTCGGGTACAGACGCTGGACGACTCTCTTCAGCCGACGATGGATATGCTG
CTCAACGTATCCATCTTTCTCTGGTACGGGGCGTCGCTCCCCTGGAACCTGTTTAGCCAAAACTCGGTCATTTCC
ACCGGCCGTCTCGTCGCTCTCGGCCTGCTCGTGCTGCTTCTTCGACGGCTTCCGTGGATCTACTGCTTACACTGG
TGGATTCCCCAGCTTCGGAACGCCAAAAGGGCCGTCTTTGTCGGCTTTTTTGGTCCTATGGGCGTCTCGGCCGTC
TTTTACCTACTCATCTCTCTGAACTTCATCGACGATCATCTGAGCGATGAGACGGGACAGCCTAGGAGTGACGTG
AAGAATTTTGGCGAAACCATGCGTGTTGTCGTTTGGTTTCTCGTCGTCTGTAGTACGTTGGTCCACGGACTTAGC
ATCCCGCTCGGGAGAGTGGGATACGTGGCTCCCAAGAGGATTATGCACGTTTTCAAGCGGAGGTCAAGCGATGAG
CCGCTGAGGGTCGAGGCTCGAAGTAAGATACCCGTCATTGGGAGATACATAAGCAGAAGCGCGAGTGTCACGGTC
GATGCCTGGCGTCCCTGGACGGCGTTGGAGCTTCGCGTGTTGCGCCCGGTTCATTGGGGACCTGATCGCTCGACT
CGGACGGTTGACGGCTCTACGGCTGGGTCGGGGTCTGCGACGCCAATTGGAAAGAATAACTTCGTTGTCGTTGAT
CTGGCCGCTAGAGCCAAAAGCGTCTTCAGCGTTCAGCCGGCCACGAACAGCGAGAAGGGGAACAGTGCTGCTATC
AATCTCCCTACAGGAGCTGGACTCAACCATTATGGTGCTAGCCAGGCGAATATTTCCGCAACGAGCCTCAACGTC
TCCGTTATTCAACTACCTAATTGA
Gene >Ophcf2|06555
ATGACGCAAAAAAAGGTTTGGGCGATTCCGCTCGAGTTATCCAATTACAACGTCATCGTCGCCCTGCTTGGTGGC
TTCATCTCATTGTTCGGATTGGTATCTTTTCTATTAAAGGAGAATTTCTATCTTTCCGAGTCTCGTAAGTCTTCA
ATGTCTCGATGCAACGTCGGCGTTCAATCACCTCCTACCTATTGTGAGTGACATGGTTGCTGACCTCTGCGTCGC
AGTCATCTCTCTCCTGGCGGGTCTCGCCTTCGGGCCGCTGGGCGCAAACTTGATTCGTCCTGGAGCCTATGTTCA
GTGCGATGACACGGCCATCCCGGACGTCAGGTGCGAGGCCAGCCTCAACCACATCACCCTCAACTTCTCTCGCCT
TGTTCTCGCCATTCAGCTTGTTCTGGCGGGAGTTCAGCTGCCTAGGAAATACCTGTGGAAAGAATACAAGCCCAT
CTTGTTGCTCATCGGTCCTGGAATGACGTGCATGTGGCTCGCTACGAGCCTGCTGGTCTGGGGCCTTGCAGATAC
ACCTGGCATTCTACAGGCCTTGGCTATCGGTGCCTGCGTCACGCCAACGGACCCTGTCCTCTCGGCTGTGATCAT
CAAGGGCAAGTTTGCCAACGAGAATGTCCCCAAGGACCTTCAGGATCTAGTCGTCGCGGAGTCTGGGGCAAACGA
CGGGCTCGGCTACCCGTTCTTGTTTCTTGCCCTGTATCTCATCAAGTTCCTCGGCCCGACAGCCTCATCTGGCGG
CGCTAGAGAGGCCATGGGCCTCTGGTTCGCCATGACGTGGTCGTATACGATTCTACTAAGCATAATCTTTGGCGC
CGTGGTGGGTTATCTAGCCAAGGAGCTGCTCCGTTGGGCCAAAGAACGGGGTTACGTCGACCGCGAAGCCTTTAC
CGTCTTCTCTATAGCCCTCGCTCTCTTCGTCTTTGGGACATGCGGCTTGATCGGCACCGACGATCTTCTCGCCTG
CTTCATCGCCGGCAATGCCTTTACGTGGGACGACTGGTTTCGGGTACAGACGCTGGACGACTCTCTTCAGCCGAC
GATGGATATGCTGCTCAACGTATCCATCTTTCTCTGGTACGGGGCGTCGCTCCCCTGGAACCTGTTTAGCCAAAA
CTCGGTCATTTCCACCGGCCGTCTCGTCGCTCTCGGCCTGCTCGTGCTGCTTCTTCGACGGCTTCCGTGGATCTA
CTGCTTACACTGGTGGATTCCCCAGCTTCGGAACGCCAAAAGGGCCGTCTTTGTCGGCTTTTTTGGTCCTATGGG
CGTCTCGGCCGTCTTTTACCTACTCATCTCTCTGAACTTCATCGACGATCATCTGAGCGATGAGACGGGACAGCC
TAGGAGTGACGTGAAGAATTTTGGCGAAACCATGCGTGTTGTCGTTTGGTTTCTCGTCGTCTGTAGTACGGTGAG
TGATTTCCTTCGGGTGGTCTTCCCCCCTTTTTCACTAATTGCGACGCTGTTTTAACATTTGACCGTGATAGTTGG
TCCACGGACTTAGCATCCCGCTCGGGAGAGTGGGATACGTGGCTCCCAAGAGGATTATGCACGTTTTCAAGCGGA
GGTCAAGCGATGAGCCGCTGAGGGTCGAGGCTCGAAGTAAGATACCCGTCATTGGGAGATACATAAGCAGAAGCG
CGAGTGTCACGGTCGATGCCTGGCGTCCCTGGACGGCGTTGGAGCTTCGCGTGTTGCGCCCGGTTCATTGGGGAC
CTGATCGCTCGACTCGGACGGTTGACGGCTCTACGGCTGGGTCGGGGTCTGCGACGCCAGTTTGGCGACGGAGTG
GAAGTAGGGCTTCTGATGAGACTCGGGTGGGAGGTGGTGATAGAATGGTACGGAGGGAAGGTGATGAATGATGAT
GAAAATGAAGGATGATGAGGAGGAAAAGGTAAATGAAATGGATGACTGAATGACGAGCGAGGGTTGACCTGAGAG
ATTGGAAAGGTATGTAACGACAAAGACGCACGTTGCGTGTGGACATTCAACTTACAGCATGGCTTAGAATAACTT
CGTTGTCGTTGATCTGGCCGCTAGAGCCAAAAGCGTCTTCAGCGTTCAGCCGGCCACGAACAGCGAGAAGGGGAA
CAGTGCTGCTATCAATCTCCCTACAGGAGCTGGACTCAACCATTATGGTGCTAGCCAGGCGAATATTTCCGCAAC
GAGCCTCAACGTCTCCGTTATTCAACTACCTAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail