Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06554
Gene name
Locationscaffold_08:418129..420441
Strand+
Gene length (bp)2312
Transcript length (bp)2208
Coding sequence length (bp)2208
Protein length (aa) 736

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00199 Catalase Catalase 3.5E-163 60 444
PF18011 Catalase_C C-terminal domain found in long catalases 8.8E-47 571 715
PF06628 Catalase-rel Catalase-related immune-responsive 1.4E-15 477 539

GO

GO Term Description Terminal node
GO:0020037 heme binding Yes
GO:0004096 catalase activity Yes
GO:0016209 antioxidant activity No
GO:0004601 peroxidase activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:1901363 heterocyclic compound binding No
GO:0046906 tetrapyrrole binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.141 0.0409 0.9523 0.0814 0.1502 0.0643 0.2543 0.2664 0.2478 0.0098

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.989709

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup68
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|371
Ophiocordyceps australis 1348a (Ghana) OphauG2|3843
Ophiocordyceps australis 1348a (Ghana) OphauG2|7342
Ophiocordyceps australis map64 (Brazil) OphauB2|2376
Ophiocordyceps australis map64 (Brazil) OphauB2|5685
Ophiocordyceps camponoti-floridani Ophcf2|06554 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06933
Ophiocordyceps camponoti-rufipedis Ophun1|2887
Ophiocordyceps camponoti-rufipedis Ophun1|6205
Ophiocordyceps kimflemingae Ophio5|2647
Ophiocordyceps kimflemingae Ophio5|3736
Ophiocordyceps subramaniannii Hirsu2|11160
Ophiocordyceps subramaniannii Hirsu2|2168
Ophiocordyceps subramaniannii Hirsu2|2204
Ophiocordyceps subramaniannii Hirsu2|8801

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06554
MHRHVFALAVAWAGLVRSECPLASSGHVFARDESASRSNPGSRGHVSQADVDGSKGFMNTEGGQPIADQESLKAG
PRGPTLLEDFIFRRKITHFDHERIPERAVHARGAGAYGTFTSYGSFSNITAASFLSAEGKKTNVFVRFSTVAGSR
GSADTVRDVHGFATRFYTDEGNFDLVGNNIPVFFIQDAIKFPDLIHAVKPNMKLEIPTAATAHDEAWDFFSQQPS
TLHTLMWAMAGYGIPRSYRHMPGFGVHTFRLVNDKGESKLVKWVWTPMQGKASLVWEEAQHIAGNDADYHRRDLA
HAIDTGVFPEWELNVQIIDEDEALAYGFDVLDATKFVPEEIAPLQKLGKMQLNSNPVNYFSETEQVMFQVGNIVR
GIDFTEDPLLQGRIFSYLDTQLNRAMGSPNFEQIPVNRPAVAVNNNNRDGPMQTLNYKNTAAYTPNTLNNGFPAQ
ANQTVGKGFFTAPGRQVRGFLTREMSSTFSDHWSQPRLFLNSIGPVDQQQVVNAIRFETSQVQPRIQKQVLMQLN
RVSNDLAKRVAVALGMEAPAPDGQYYHDNRTRGLSIFDVKLPTVAGFAVGVLVSLDAPDSLAQAQALREALKSAK
VEVKMVGERLVSGVDVTYSAASATAFDAIVVAEGVEVIMDDYKQSTLYPAGRPSSIVTDGYRWGKPIGFLGSAQK
AAKAAGVKMGEGVYSVGDVQDMAREVSEGLATFKFTDRFPMDGQAKRMYETKKEKQEESS*
Coding >Ophcf2|06554
ATGCATCGACACGTCTTTGCCCTCGCTGTGGCCTGGGCTGGCCTCGTCCGCTCTGAGTGTCCCCTCGCCAGCTCC
GGCCACGTCTTCGCCAGGGACGAGTCGGCGTCCCGTTCCAACCCCGGCTCTCGCGGCCACGTCTCTCAGGCCGAT
GTCGATGGTAGCAAGGGCTTCATGAACACAGAAGGTGGCCAACCCATAGCCGACCAGGAAAGCCTCAAGGCCGGA
CCTCGAGGTCCCACGCTGCTTGAGGACTTCATCTTCCGCCGCAAAATCACGCACTTTGATCATGAGCGGATACCG
GAACGAGCTGTCCACGCTCGCGGAGCTGGCGCCTACGGCACTTTCACCAGCTACGGCTCCTTCAGCAACATCACC
GCCGCCAGCTTCCTCAGCGCCGAGGGCAAAAAGACGAACGTCTTCGTCCGCTTCTCCACCGTCGCTGGCTCCCGC
GGCTCTGCCGACACGGTCCGCGACGTCCACGGCTTCGCCACGCGTTTCTATACCGACGAGGGCAACTTTGATCTG
GTGGGAAACAACATCCCCGTCTTCTTTATCCAGGACGCCATCAAGTTCCCCGATCTTATCCACGCCGTCAAGCCC
AACATGAAGCTCGAGATTCCCACTGCCGCCACGGCCCATGACGAGGCCTGGGACTTTTTCAGTCAGCAGCCCAGC
ACCCTTCACACTCTGATGTGGGCCATGGCGGGATACGGCATCCCGCGCAGCTATCGACACATGCCGGGTTTTGGC
GTTCACACATTTCGTCTCGTCAACGACAAGGGCGAGTCGAAGCTGGTCAAGTGGGTGTGGACACCGATGCAAGGA
AAGGCCAGTCTGGTCTGGGAGGAGGCGCAGCACATTGCGGGCAACGATGCCGACTATCACCGGCGAGACCTGGCG
CACGCCATCGACACCGGCGTCTTCCCTGAGTGGGAGCTCAACGTGCAGATCATTGACGAGGATGAGGCTCTTGCC
TACGGCTTCGATGTCCTGGACGCGACCAAGTTTGTTCCCGAAGAGATTGCGCCGCTCCAGAAGCTCGGCAAGATG
CAGCTCAACTCGAATCCCGTCAACTACTTTAGCGAGACGGAGCAGGTCATGTTCCAGGTCGGCAACATCGTCAGG
GGCATCGACTTCACCGAGGACCCTCTGCTGCAGGGCCGCATCTTTTCCTACCTCGACACGCAGCTCAACCGAGCC
ATGGGCAGCCCCAACTTTGAGCAGATTCCGGTCAACCGGCCTGCCGTTGCCGTGAACAACAACAACCGGGACGGT
CCAATGCAGACGCTGAACTACAAGAACACGGCCGCCTACACTCCCAACACGCTCAACAACGGTTTCCCGGCGCAG
GCGAACCAGACGGTCGGCAAGGGCTTCTTCACTGCTCCCGGTCGTCAGGTCAGAGGTTTTCTCACGCGCGAGATG
AGCTCGACATTTTCAGATCATTGGTCCCAGCCTCGACTCTTCCTCAACTCCATCGGCCCCGTGGATCAGCAGCAG
GTGGTCAACGCCATCCGATTCGAGACGAGCCAAGTGCAGCCGAGGATTCAGAAGCAGGTACTGATGCAGCTCAAC
CGCGTCAGCAACGACCTCGCCAAGCGCGTGGCGGTGGCCCTGGGCATGGAGGCACCGGCACCCGACGGCCAGTAC
TACCACGACAACCGCACGCGGGGCCTGAGCATCTTTGACGTGAAGCTGCCGACAGTCGCCGGGTTCGCGGTAGGC
GTGCTGGTCTCGCTGGACGCGCCGGACTCGCTGGCTCAGGCTCAGGCGCTGCGGGAGGCGCTGAAGTCGGCCAAG
GTGGAGGTGAAGATGGTGGGCGAGAGGTTGGTTTCGGGCGTCGACGTGACTTACTCGGCGGCTTCGGCGACGGCA
TTCGACGCCATCGTCGTGGCTGAGGGCGTCGAGGTCATCATGGACGATTACAAGCAGTCGACGCTATATCCCGCC
GGGCGACCCTCGTCCATCGTGACGGACGGATACCGCTGGGGTAAGCCGATTGGCTTCCTGGGCAGCGCGCAGAAG
GCGGCCAAGGCGGCAGGGGTTAAGATGGGCGAGGGTGTCTATTCGGTTGGCGACGTGCAGGACATGGCGCGGGAG
GTGAGTGAGGGGCTGGCGACGTTCAAGTTTACCGATCGCTTCCCGATGGACGGGCAGGCGAAGCGGATGTATGAG
ACGAAGAAGGAGAAGCAGGAGGAGTCGAGTTAG
Transcript >Ophcf2|06554
ATGCATCGACACGTCTTTGCCCTCGCTGTGGCCTGGGCTGGCCTCGTCCGCTCTGAGTGTCCCCTCGCCAGCTCC
GGCCACGTCTTCGCCAGGGACGAGTCGGCGTCCCGTTCCAACCCCGGCTCTCGCGGCCACGTCTCTCAGGCCGAT
GTCGATGGTAGCAAGGGCTTCATGAACACAGAAGGTGGCCAACCCATAGCCGACCAGGAAAGCCTCAAGGCCGGA
CCTCGAGGTCCCACGCTGCTTGAGGACTTCATCTTCCGCCGCAAAATCACGCACTTTGATCATGAGCGGATACCG
GAACGAGCTGTCCACGCTCGCGGAGCTGGCGCCTACGGCACTTTCACCAGCTACGGCTCCTTCAGCAACATCACC
GCCGCCAGCTTCCTCAGCGCCGAGGGCAAAAAGACGAACGTCTTCGTCCGCTTCTCCACCGTCGCTGGCTCCCGC
GGCTCTGCCGACACGGTCCGCGACGTCCACGGCTTCGCCACGCGTTTCTATACCGACGAGGGCAACTTTGATCTG
GTGGGAAACAACATCCCCGTCTTCTTTATCCAGGACGCCATCAAGTTCCCCGATCTTATCCACGCCGTCAAGCCC
AACATGAAGCTCGAGATTCCCACTGCCGCCACGGCCCATGACGAGGCCTGGGACTTTTTCAGTCAGCAGCCCAGC
ACCCTTCACACTCTGATGTGGGCCATGGCGGGATACGGCATCCCGCGCAGCTATCGACACATGCCGGGTTTTGGC
GTTCACACATTTCGTCTCGTCAACGACAAGGGCGAGTCGAAGCTGGTCAAGTGGGTGTGGACACCGATGCAAGGA
AAGGCCAGTCTGGTCTGGGAGGAGGCGCAGCACATTGCGGGCAACGATGCCGACTATCACCGGCGAGACCTGGCG
CACGCCATCGACACCGGCGTCTTCCCTGAGTGGGAGCTCAACGTGCAGATCATTGACGAGGATGAGGCTCTTGCC
TACGGCTTCGATGTCCTGGACGCGACCAAGTTTGTTCCCGAAGAGATTGCGCCGCTCCAGAAGCTCGGCAAGATG
CAGCTCAACTCGAATCCCGTCAACTACTTTAGCGAGACGGAGCAGGTCATGTTCCAGGTCGGCAACATCGTCAGG
GGCATCGACTTCACCGAGGACCCTCTGCTGCAGGGCCGCATCTTTTCCTACCTCGACACGCAGCTCAACCGAGCC
ATGGGCAGCCCCAACTTTGAGCAGATTCCGGTCAACCGGCCTGCCGTTGCCGTGAACAACAACAACCGGGACGGT
CCAATGCAGACGCTGAACTACAAGAACACGGCCGCCTACACTCCCAACACGCTCAACAACGGTTTCCCGGCGCAG
GCGAACCAGACGGTCGGCAAGGGCTTCTTCACTGCTCCCGGTCGTCAGGTCAGAGGTTTTCTCACGCGCGAGATG
AGCTCGACATTTTCAGATCATTGGTCCCAGCCTCGACTCTTCCTCAACTCCATCGGCCCCGTGGATCAGCAGCAG
GTGGTCAACGCCATCCGATTCGAGACGAGCCAAGTGCAGCCGAGGATTCAGAAGCAGGTACTGATGCAGCTCAAC
CGCGTCAGCAACGACCTCGCCAAGCGCGTGGCGGTGGCCCTGGGCATGGAGGCACCGGCACCCGACGGCCAGTAC
TACCACGACAACCGCACGCGGGGCCTGAGCATCTTTGACGTGAAGCTGCCGACAGTCGCCGGGTTCGCGGTAGGC
GTGCTGGTCTCGCTGGACGCGCCGGACTCGCTGGCTCAGGCTCAGGCGCTGCGGGAGGCGCTGAAGTCGGCCAAG
GTGGAGGTGAAGATGGTGGGCGAGAGGTTGGTTTCGGGCGTCGACGTGACTTACTCGGCGGCTTCGGCGACGGCA
TTCGACGCCATCGTCGTGGCTGAGGGCGTCGAGGTCATCATGGACGATTACAAGCAGTCGACGCTATATCCCGCC
GGGCGACCCTCGTCCATCGTGACGGACGGATACCGCTGGGGTAAGCCGATTGGCTTCCTGGGCAGCGCGCAGAAG
GCGGCCAAGGCGGCAGGGGTTAAGATGGGCGAGGGTGTCTATTCGGTTGGCGACGTGCAGGACATGGCGCGGGAG
GTGAGTGAGGGGCTGGCGACGTTCAAGTTTACCGATCGCTTCCCGATGGACGGGCAGGCGAAGCGGATGTATGAG
ACGAAGAAGGAGAAGCAGGAGGAGTCGAGTTAG
Gene >Ophcf2|06554
ATGCATCGACACGTCTTTGCCCTCGCTGTGGCCTGGGCTGGCCTCGTCCGCTCTGAGTGTCCCCTCGCCAGCTCC
GGCCACGTCTTCGCCAGGGACGAGTCGGCGTCCCGTTCCAACCCCGGCTCTCGCGGCCACGTCTCTCAGGCCGAT
GTCGATGGTAGCAAGGGCTTCATGAACACAGAAGGTGGCCAACCCATAGCCGACCAGGAAAGCCTCAAGGCCGGA
CCTCGAGGTCCCACGCTGCTTGAGGACTTCATCTTCCGCCGCAAAATCACGCACTTTGATCATGAGCGGGTGAGT
GCCTTGCCCGAGCTTCGTTTTCTGGCTGCTGACCCTGTCAAGATACCGGAACGAGCTGTCCACGCTCGCGGAGCT
GGCGCCTACGGCACTTTCACCAGCTACGGCTCCTTCAGCAACATCACCGCCGCCAGCTTCCTCAGCGCCGAGGGC
AAAAAGACGAACGTCTTCGTCCGCTTCTCCACCGTCGCTGGCTCCCGCGGCTCTGCCGACACGGTCCGCGACGTC
CACGGCTTCGCCACGCGTTTCTATACCGACGAGGGCAACTTTGATCTGGTGGGAAACAACATCCCCGTCTTCTTT
ATCCAGGACGCCATCAAGTTCCCCGATCTTATCCACGCCGTCAAGCCCAACATGAAGCTCGAGATTCCCACTGCC
GCCACGGCCCATGACGAGGCCTGGGACTTTTTCAGTCAGCAGCCCAGCACCCTTCACACTCTGATGTGGGCCATG
GCGGGATACGGCATCCCGCGCAGCTATCGACACATGGTGTGTTTTCCCACCTGCAGAGGGATGAAAATTCCAAGG
TTGCTGACATGCCTCAGCCGGGTTTTGGCGTTCACACATTTCGTCTCGTCAACGACAAGGGCGAGTCGAAGCTGG
TCAAGTGGGTGTGGACACCGATGCAAGGAAAGGCCAGTCTGGTCTGGGAGGAGGCGCAGCACATTGCGGGCAACG
ATGCCGACTATCACCGGCGAGACCTGGCGCACGCCATCGACACCGGCGTCTTCCCTGAGTGGGAGCTCAACGTGC
AGATCATTGACGAGGATGAGGCTCTTGCCTACGGCTTCGATGTCCTGGACGCGACCAAGTTTGTTCCCGAAGAGA
TTGCGCCGCTCCAGAAGCTCGGCAAGATGCAGCTCAACTCGAATCCCGTCAACTACTTTAGCGAGACGGAGCAGG
TCATGTTCCAGGTCGGCAACATCGTCAGGGGCATCGACTTCACCGAGGACCCTCTGCTGCAGGGCCGCATCTTTT
CCTACCTCGACACGCAGCTCAACCGAGCCATGGGCAGCCCCAACTTTGAGCAGATTCCGGTCAACCGGCCTGCCG
TTGCCGTGAACAACAACAACCGGGACGGTCCAATGCAGACGCTGAACTACAAGAACACGGCCGCCTACACTCCCA
ACACGCTCAACAACGGTTTCCCGGCGCAGGCGAACCAGACGGTCGGCAAGGGCTTCTTCACTGCTCCCGGTCGTC
AGGTCAGAGGTTTTCTCACGCGCGAGATGAGCTCGACATTTTCAGATCATTGGTCCCAGCCTCGACTCTTCCTCA
ACTCCATCGGCCCCGTGGATCAGCAGCAGGTGGTCAACGCCATCCGATTCGAGACGAGCCAAGTGCAGCCGAGGA
TTCAGAAGCAGGTACTGATGCAGCTCAACCGCGTCAGCAACGACCTCGCCAAGCGCGTGGCGGTGGCCCTGGGCA
TGGAGGCACCGGCACCCGACGGCCAGTACTACCACGACAACCGCACGCGGGGCCTGAGCATCTTTGACGTGAAGC
TGCCGACAGTCGCCGGGTTCGCGGTAGGCGTGCTGGTCTCGCTGGACGCGCCGGACTCGCTGGCTCAGGCTCAGG
CGCTGCGGGAGGCGCTGAAGTCGGCCAAGGTGGAGGTGAAGATGGTGGGCGAGAGGTTGGTTTCGGGCGTCGACG
TGACTTACTCGGCGGCTTCGGCGACGGCATTCGACGCCATCGTCGTGGCTGAGGGCGTCGAGGTCATCATGGACG
ATTACAAGCAGTCGACGCTATATCCCGCCGGGCGACCCTCGTCCATCGTGACGGACGGATACCGCTGGGGTAAGC
CGATTGGCTTCCTGGGCAGCGCGCAGAAGGCGGCCAAGGCGGCAGGGGTTAAGATGGGCGAGGGTGTCTATTCGG
TTGGCGACGTGCAGGACATGGCGCGGGAGGTGAGTGAGGGGCTGGCGACGTTCAAGTTTACCGATCGCTTCCCGA
TGGACGGGCAGGCGAAGCGGATGTATGAGACGAAGAAGGAGAAGCAGGAGGAGTCGAGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail