Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06552
Gene name
Locationscaffold_08:413180..414600
Strand-
Gene length (bp)1420
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01733 Nucleoside_tran Nucleoside transporter 6.3E-42 142 447

GO

GO Term Description Terminal node
GO:0005337 nucleoside transmembrane transporter activity Yes
GO:1901642 nucleoside transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0006810 transport No
GO:1901264 carbohydrate derivative transport No
GO:0071702 organic substance transport No
GO:1901505 carbohydrate derivative transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0015931 nucleobase-containing compound transport No
GO:0003674 molecular_function No
GO:0071705 nitrogen compound transport No
GO:0015858 nucleoside transport No
GO:0055085 transmembrane transport No
GO:0015932 nucleobase-containing compound transmembrane transporter activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 73 92 19
3 105 127 22
4 137 159 22
5 172 194 22
6 220 242 22
7 284 306 22
8 356 375 19
9 388 410 22
10 425 447 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 48.21 26.82 69.60
Alive In ants, during behavior modification 42.94 23.29 62.59
Dead In ants, recently dead 44.14 24.29 64.00

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.617813 no
Alive Dead 0.900420 no
Dead Fungus 0.704407 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06552
MEGSRTAYRRLGTDMDDDDAGSVVTEGPPFSWLEYAIFGFLGVAMLWAWNMFLAAAPYFSSRFAADAWIEANFQS
AILASSTLVNLGTLVVLTKLQREASYTFRINLALVINTLVFALLTCSTALFLDASPSSYLAFLLLVVAAASWATG
LSQNGCFAFAASFGRPEYTQAIMAGQSVAGVLPAVAQVITVLLFPPKQHRATVGDGHGREDVPAKGQTSAFVYFL
TAVAISVAALLALATLVRRHRALLENSRLLPDGMEASVNSIQDAERASRKVATLWHLFVKLRWLALGVALTFAAT
MFFPVFTTKTLSVHPDAAPLFRPAAFIPLAFLCWNLGDLVGRVLAVLPLSLRHRPFYLFVLSVIRIGQLPLYLLC
NIGGRGASVPSDFFYLVIVQLLFGLTNGWLGSSFMMAAGEWVEPGEREAAGAFMGLCLVVGLALGSFLSFTIADI
*
Coding >Ophcf2|06552
ATGGAAGGCTCAAGAACCGCTTACCGGCGTCTGGGCACCGACATGGACGACGATGACGCCGGCTCCGTCGTCACC
GAAGGGCCGCCCTTCTCATGGCTCGAGTACGCCATCTTTGGCTTCCTCGGCGTCGCCATGCTCTGGGCCTGGAAC
ATGTTCCTCGCCGCCGCGCCCTACTTCTCGTCTCGGTTCGCAGCCGACGCCTGGATAGAAGCCAACTTCCAGTCC
GCCATCCTCGCATCCTCTACGCTCGTCAACCTCGGCACCCTTGTCGTTCTCACGAAGCTACAGCGCGAGGCCTCG
TACACGTTCCGCATCAATCTAGCTCTCGTCATCAACACTCTCGTCTTCGCCCTCCTCACCTGCTCGACCGCTCTC
TTCCTCGACGCCTCCCCCTCGTCCTATCTCGCCTTTCTTCTCCTCGTCGTCGCCGCCGCTTCTTGGGCGACCGGC
CTCAGTCAAAATGGTTGTTTTGCCTTTGCCGCCAGCTTCGGTCGGCCAGAGTACACGCAGGCGATCATGGCCGGC
CAGAGCGTCGCCGGCGTCCTCCCCGCCGTCGCCCAGGTCATCACCGTTCTACTCTTCCCGCCCAAGCAACACCGT
GCTACCGTCGGCGACGGCCATGGCCGTGAAGACGTACCTGCCAAGGGACAGACGTCGGCCTTTGTCTATTTCCTC
ACCGCCGTCGCCATCTCCGTCGCTGCCCTCTTGGCGCTTGCCACTCTCGTGCGGAGACACCGCGCCCTTCTCGAA
AACAGTCGGCTCTTGCCCGACGGCATGGAAGCCTCCGTCAACAGCATCCAAGACGCCGAGCGAGCCTCCCGCAAG
GTGGCGACGCTATGGCACCTCTTCGTCAAGCTCCGCTGGCTCGCGCTTGGCGTCGCACTCACATTTGCCGCCACC
ATGTTCTTCCCCGTCTTTACTACCAAGACGCTCTCCGTCCATCCAGACGCCGCTCCGCTCTTCCGCCCTGCCGCC
TTCATCCCGCTCGCCTTCCTGTGCTGGAACCTTGGCGACCTGGTCGGCAGGGTCCTCGCCGTCCTACCTTTATCG
CTGCGGCACCGACCCTTTTACCTCTTCGTTCTCTCCGTCATCCGCATCGGCCAGTTGCCGCTCTACCTGCTCTGC
AATATTGGCGGCCGGGGCGCCTCGGTCCCCAGCGACTTCTTCTATCTCGTCATCGTCCAGCTCTTGTTCGGCCTG
ACCAATGGCTGGCTGGGCTCGAGCTTCATGATGGCTGCCGGTGAATGGGTCGAGCCGGGGGAGCGTGAGGCCGCC
GGTGCCTTTATGGGCCTCTGTCTAGTCGTCGGCTTGGCCTTGGGCAGCTTCCTGAGCTTTACCATCGCCGACATC
TAA
Transcript >Ophcf2|06552
ATGGAAGGCTCAAGAACCGCTTACCGGCGTCTGGGCACCGACATGGACGACGATGACGCCGGCTCCGTCGTCACC
GAAGGGCCGCCCTTCTCATGGCTCGAGTACGCCATCTTTGGCTTCCTCGGCGTCGCCATGCTCTGGGCCTGGAAC
ATGTTCCTCGCCGCCGCGCCCTACTTCTCGTCTCGGTTCGCAGCCGACGCCTGGATAGAAGCCAACTTCCAGTCC
GCCATCCTCGCATCCTCTACGCTCGTCAACCTCGGCACCCTTGTCGTTCTCACGAAGCTACAGCGCGAGGCCTCG
TACACGTTCCGCATCAATCTAGCTCTCGTCATCAACACTCTCGTCTTCGCCCTCCTCACCTGCTCGACCGCTCTC
TTCCTCGACGCCTCCCCCTCGTCCTATCTCGCCTTTCTTCTCCTCGTCGTCGCCGCCGCTTCTTGGGCGACCGGC
CTCAGTCAAAATGGTTGTTTTGCCTTTGCCGCCAGCTTCGGTCGGCCAGAGTACACGCAGGCGATCATGGCCGGC
CAGAGCGTCGCCGGCGTCCTCCCCGCCGTCGCCCAGGTCATCACCGTTCTACTCTTCCCGCCCAAGCAACACCGT
GCTACCGTCGGCGACGGCCATGGCCGTGAAGACGTACCTGCCAAGGGACAGACGTCGGCCTTTGTCTATTTCCTC
ACCGCCGTCGCCATCTCCGTCGCTGCCCTCTTGGCGCTTGCCACTCTCGTGCGGAGACACCGCGCCCTTCTCGAA
AACAGTCGGCTCTTGCCCGACGGCATGGAAGCCTCCGTCAACAGCATCCAAGACGCCGAGCGAGCCTCCCGCAAG
GTGGCGACGCTATGGCACCTCTTCGTCAAGCTCCGCTGGCTCGCGCTTGGCGTCGCACTCACATTTGCCGCCACC
ATGTTCTTCCCCGTCTTTACTACCAAGACGCTCTCCGTCCATCCAGACGCCGCTCCGCTCTTCCGCCCTGCCGCC
TTCATCCCGCTCGCCTTCCTGTGCTGGAACCTTGGCGACCTGGTCGGCAGGGTCCTCGCCGTCCTACCTTTATCG
CTGCGGCACCGACCCTTTTACCTCTTCGTTCTCTCCGTCATCCGCATCGGCCAGTTGCCGCTCTACCTGCTCTGC
AATATTGGCGGCCGGGGCGCCTCGGTCCCCAGCGACTTCTTCTATCTCGTCATCGTCCAGCTCTTGTTCGGCCTG
ACCAATGGCTGGCTGGGCTCGAGCTTCATGATGGCTGCCGGTGAATGGGTCGAGCCGGGGGAGCGTGAGGCCGCC
GGTGCCTTTATGGGCCTCTGTCTAGTCGTCGGCTTGGCCTTGGGCAGCTTCCTGAGCTTTACCATCGCCGACATC
TAA
Gene >Ophcf2|06552
ATGGAAGGCTCAAGAACCGCTTACCGGCGTCTGGGCACCGACATGGACGACGATGACGCCGGCTCCGTCGTCACC
GAAGGGCCGCCCTTCTCATGGCTCGAGTACGCCATCTTTGGCTTCCTCGGCGTCGCCATGCTCTGGGCCTGGTTC
GTCTCTCCCTTCTCCTGATCAAAGAAGGCGGAGGGAGACCTCTTCTGACGTCGGCGTCACCAGGAACATGTTCCT
CGCCGCCGCGCCCTACTTCTCGTCTCGGTTCGCAGCCGACGCCTGGATAGAAGCCAACTTCCAGTCCGCCATCCT
CGCATCCTCTACGCTCGTCAACCTCGGCACCCTTGTCGTTCTCACGAAGCTACAGCGCGAGGCCTCGTACACGTT
CCGCATCAATCTAGCTCTCGTCATCAACACTCTCGTCTTCGCCCTCCTCACCTGCTCGACCGCTCTCTTCCTCGA
CGCCTCCCCCTCGTCCTATCTCGCCTTTCTTCTCCTCGTCGTCGCCGCCGCTTCTTGGGCGACCGGCCTCAGTCA
AAATGGTTGTTTTGCCTTTGCCGCCAGCTTCGGTCGGCCAGAGTACACGCAGGCGATCATGGCCGGCCAGAGCGT
CGCCGGCGTCCTCCCCGCCGTCGCCCAGGTCATCACCGTTCTACTCTTCCCGCCCAAGCAACACCGTGCTACCGT
CGGCGACGGCCATGGCCGTGAAGACGTACCTGCCAAGGGACAGACGTCGGCCTTTGTCTATTTCCTCACCGCCGT
CGCCATCTCCGTCGCTGCCCTCTTGGCGCTTGCCACTCTCGTGCGGAGACACCGCGCCCTTCTCGAAAACAGTCG
GCTCTTGCCCGACGGCATGGAAGCCTCCGTCAACAGCATCCAAGACGCCGAGCGAGCCTCCCGCAAGGTGGCGAC
GCTATGGCACCTCTTCGTCAAGCTCCGCTGGCTCGCGCTTGGCGTCGCACTCACATTTGCCGCCACCATGTTCTT
CCCCGTCTTTACTACCAAGACGCTCTCCGTCCATCCAGACGCCGCTCCGCTCTTCCGCCCTGCCGCCTTCATCCC
GCTCGCCTTCCTGTGCTGGAACCTTGGCGACCTGGTCGGCAGGGTCCTCGCCGTCCTACCTTTATCGCTGCGGCA
CCGACCCTTTTACCTCTTCGTTCTCTCCGTCATCCGCATCGGCCAGTTGCCGCTCTACCTGCTCTGCAATATTGG
CGGCCGGGGCGCCTCGGTCCCCAGCGACTTCTTCTATCTCGTCATCGTCCAGCTCTTGTTCGGCCTGACCAATGG
CTGGCTGGGCTCGAGCTTCATGATGGCTGCCGGTGAATGGGTCGAGCCGGGGGAGCGTGAGGCCGCCGGTGCCTT
TATGGGCCTCTGTCTAGTCGTCGGCTTGGCCTTGGGCAGCTTCCTGAGCTTTACCATCGCCGACATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail