Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06544
Gene name
Locationscaffold_08:392800..397046
Strand+
Gene length (bp)4246
Transcript length (bp)4065
Coding sequence length (bp)4065
Protein length (aa) 1355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 3.0E-83 1026 1277
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 1.1E-26 228 294
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.6E-10 686 776
PF00122 E1-E2_ATPase E1-E2 ATPase 1.2E-06 322 513

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 492 514 22
2 544 566 22
3 1097 1119 22
4 1139 1161 22
5 1176 1198 22
6 1205 1227 22
7 1249 1268 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06544
MAGPPRQGGDPSSRKADDLLLDLDVDQPAAYNDGQRSTLNDDDLLRLHTLDSARSPPPSSSQRRPSVSYDDFVGG
GPSSSGRSPLTPHTPYLAKHYSQTSDLDNYRRYVDDELEDYPDSCYRRASSPSAAAAAAATAAAAGHQNARNRNS
VLSLGGGLLGRVKNKLGMGEGYSEMDLPLTEPGRDRLAAGSGAKDHNNKASSKFDMGNFKFGFGRSKPDPSTLGP
RIVHLNNPPANAANKYVDNHISTAKYNFATFLPKFLVEQFSKFANVFFLFTAGLQQIPGLSPTNRYTTIAPLLIV
LLISAGKELVEDYRRKQADNALNTSKARVLRGSAFTETKWINVGVGDVVRVQSEEPFPADLVLLASSEPEGLCYI
ETANLDGETNLKIKQALPETSAMVSSSELSRLGGRIKSEQPNSSLYTYEATLTMQAGGGEKELALNPEQLLLRGA
TLRNTPWIHGVVVFTGHETKLMRNATAAPIKRTKVERQLNWLVLVLVGTLLVLSVICTIGDLVLRSVRGDGLQYL
YLDRIDSAAKVTRTFARDMVTYWVLFSSLVPISLFVTVELVKYWHGILINDDLDMYHDKTDTPATCRTSSLVEEL
GMVEYVFSDKTGTLTCNQMAFKQCTIAGVQYADEVPEDRRADDGDGDGVMYDFGRLRANLAGGHETAGAMDHFLT
LLAICHTVIPEMTDDGGVKYQAASPDEGALVAGAVELGYRFTARKPRSVMIEAGGRTLEYELLAVCEFNSSRKRM
SAIYRCPDGKIRCYCKGADTVILERLGDKNGHVEATVRHLEEYASEGLRTLCLAMREIAEQEFDEWYRIFDAAAT
TVGGNRADELDKAAEIIEHDLVLLGATAIEDRLQDGVPETIHTLQQANIKVWVLTGDRQETAINIGMSCKLLSED
MMLLIVNEETAEATADNLSRKLEAIRTQADGSIETETLALVIDGKSLTYALERDLEKTFLDLAVMCRAVICCRVS
PLQKALVVKLVKKYRRESILLAIGDGANDVSMIQAAHIGVGISGMEGLQAARSADVAIAQFRYLRKLLLVHGAWS
YQRVSKTILFSFYKNIALYMTQFWYTFQNVFSGQVIYESWTLSFYNVFYTVLPPLAIGILDQFVSARLLDRYPQL
YTMGQNNESFKLRVFAEWIANAFYHSLILYVLSWLIWSGDVVMGDGAAAGHWVWGTALYGAVLLTVLGKAALVTS
NWTKYHVLAIPGSMAIWFVFIAAYGSLAPLLGVSTEYRGVVPRLFTSPLFWLQTVVLATLCLARDFWWKYVKRMY
RPQTYHHIQEIQKYNIQDYRPRMEQFQKAIRKVRQVQRMRKQRGYAFSQADESQTRVLQAYDTTKNRGRYGEMAS
SRPV*
Coding >Ophcf2|06544
ATGGCTGGTCCTCCTCGACAAGGCGGCGATCCCTCATCGCGTAAGGCCGACGACCTGCTGCTCGACCTCGACGTC
GATCAGCCAGCAGCCTACAACGACGGTCAGCGCTCGACGCTCAACGACGACGATCTTTTACGTCTTCATACCCTT
GACAGCGCCCGCTCGCCGCCTCCATCGTCGTCGCAGCGCCGTCCTTCCGTTTCCTACGACGATTTCGTCGGCGGT
GGGCCCTCGTCGTCTGGCCGCTCGCCCCTGACGCCTCACACGCCTTACCTGGCCAAGCACTACAGTCAGACGTCG
GACCTCGACAACTACCGCCGATACGTCGACGACGAACTCGAAGATTACCCGGATTCGTGTTACCGTCGCGCTTCC
TCCCCCTCAGCCGCCGCCGCCGCCGCCGCCACCGCCGCCGCCGCCGGCCATCAAAACGCCAGGAATCGCAACAGC
GTCCTGAGCCTCGGCGGCGGTCTGCTCGGCAGGGTCAAGAACAAGCTCGGTATGGGAGAGGGCTACTCAGAGATG
GACCTGCCGCTCACCGAGCCCGGTCGAGATCGGTTAGCGGCTGGCTCCGGCGCAAAGGACCACAACAACAAGGCT
TCGTCAAAGTTCGACATGGGCAACTTCAAGTTCGGCTTCGGTCGCTCCAAACCAGACCCTTCCACGCTCGGCCCC
CGTATCGTCCATCTCAACAACCCGCCGGCCAACGCGGCCAACAAGTACGTCGACAATCACATCTCGACGGCAAAG
TACAATTTCGCCACGTTTCTGCCAAAGTTCCTGGTCGAGCAGTTCTCAAAGTTCGCAAACGTCTTCTTCCTCTTC
ACCGCCGGCCTTCAGCAGATCCCGGGCCTGTCGCCGACGAATCGCTACACCACCATCGCCCCTCTCCTCATCGTC
CTCCTCATCTCGGCCGGCAAAGAGCTGGTCGAGGACTACCGCCGCAAGCAGGCCGACAACGCGCTCAACACATCC
AAGGCTCGCGTCCTGCGCGGCTCCGCCTTCACCGAGACCAAATGGATCAACGTCGGCGTCGGCGACGTCGTCCGC
GTCCAGTCCGAAGAGCCCTTCCCCGCCGACCTCGTGCTCCTGGCCAGTTCCGAGCCCGAGGGCCTCTGCTACATC
GAGACGGCCAATCTCGACGGCGAGACCAACCTCAAGATCAAGCAGGCCCTGCCCGAGACGTCGGCCATGGTCTCG
TCGAGCGAGCTCAGCCGGCTCGGCGGGCGCATCAAGTCGGAGCAGCCCAACAGCAGCCTCTACACCTACGAGGCC
ACGCTGACCATGCAGGCCGGAGGCGGCGAGAAGGAGCTGGCCCTCAACCCGGAGCAGCTGCTTCTGAGGGGCGCG
ACGCTGCGCAACACGCCCTGGATCCACGGCGTCGTCGTCTTCACCGGCCACGAGACCAAGCTGATGCGCAACGCC
ACGGCGGCGCCCATCAAGCGGACAAAGGTGGAGCGGCAGCTCAACTGGCTGGTGCTGGTGCTCGTCGGCACGCTG
CTGGTGCTGAGCGTCATCTGCACCATAGGCGACCTGGTCCTTCGCAGCGTCCGGGGCGACGGCCTGCAGTACCTG
TACCTGGACCGCATCGACAGCGCGGCCAAGGTGACGCGGACCTTTGCGCGCGACATGGTGACGTACTGGGTGCTC
TTCTCGTCTCTCGTGCCCATCTCGCTCTTCGTGACGGTGGAGCTGGTCAAGTACTGGCACGGGATCCTCATCAAC
GACGACCTCGACATGTACCACGACAAGACGGACACGCCGGCCACGTGCCGGACCTCGAGCCTGGTGGAGGAGCTG
GGCATGGTCGAGTACGTCTTCTCCGACAAGACGGGCACCCTGACGTGCAACCAGATGGCCTTTAAGCAGTGCACC
ATCGCCGGCGTCCAGTACGCCGACGAGGTGCCCGAGGACCGGCGGGCGGACGACGGCGACGGGGACGGCGTCATG
TACGACTTCGGCCGGCTGCGGGCCAACCTGGCGGGCGGGCACGAGACGGCCGGGGCCATGGACCACTTCCTGACG
CTGCTGGCCATCTGCCACACGGTGATACCCGAGATGACGGACGACGGGGGCGTCAAGTATCAGGCGGCCTCGCCG
GACGAGGGCGCGCTGGTGGCGGGCGCCGTCGAGCTCGGCTACCGCTTCACGGCGCGCAAGCCGCGGTCCGTCATG
ATCGAGGCGGGCGGACGGACGTTGGAGTACGAGCTGCTGGCGGTTTGCGAGTTCAACTCGAGCCGCAAGCGCATG
TCGGCCATCTACCGGTGCCCTGACGGCAAGATCCGATGCTACTGCAAGGGAGCCGACACCGTCATCCTCGAGAGG
CTGGGCGACAAGAACGGTCACGTCGAGGCGACTGTGCGGCACCTGGAGGAGTACGCGTCCGAGGGCCTGCGGACG
CTGTGCCTGGCGATGCGAGAGATAGCCGAGCAGGAGTTTGACGAGTGGTACCGCATCTTCGACGCCGCGGCGACG
ACGGTGGGCGGCAACCGGGCCGACGAGCTCGACAAGGCGGCCGAGATCATCGAGCACGACCTCGTGCTGCTCGGG
GCGACGGCCATCGAGGACCGGCTACAGGACGGGGTGCCCGAGACGATCCACACGCTTCAGCAGGCCAACATCAAG
GTGTGGGTGCTGACGGGGGACCGGCAGGAGACCGCCATCAACATCGGCATGAGCTGCAAGCTGCTGAGCGAGGAC
ATGATGCTGCTCATCGTCAACGAGGAGACGGCCGAGGCCACGGCCGACAACCTGAGCCGCAAGCTCGAGGCGATC
CGGACGCAGGCCGACGGCAGCATCGAGACGGAGACGCTGGCCCTCGTCATCGACGGCAAGTCGCTGACGTACGCC
CTCGAGCGCGACCTGGAGAAGACGTTTCTCGACCTGGCCGTCATGTGCAGGGCCGTCATCTGCTGCAGGGTGTCG
CCGCTGCAAAAGGCGCTGGTGGTGAAGCTGGTCAAGAAATACCGGCGCGAGAGCATCCTGCTGGCCATCGGCGAC
GGGGCCAACGACGTCTCCATGATACAGGCGGCTCACATCGGCGTCGGCATCAGCGGCATGGAGGGACTTCAGGCG
GCCCGGAGCGCGGACGTCGCCATTGCCCAGTTCCGATATCTGCGAAAGCTGCTGCTGGTTCACGGAGCGTGGAGC
TACCAGAGGGTCAGCAAGACGATATTGTTTTCCTTTTACAAGAACATTGCGCTGTACATGACGCAGTTTTGGTAC
ACGTTCCAAAACGTCTTCTCCGGTCAGGTCATCTACGAGTCCTGGACCCTCTCCTTCTACAACGTCTTCTACACC
GTCCTGCCCCCCCTCGCCATCGGCATCCTCGACCAGTTCGTCTCGGCCCGACTGCTGGACCGCTACCCGCAGCTG
TACACCATGGGCCAGAACAACGAATCCTTCAAGCTACGCGTCTTCGCCGAATGGATCGCAAACGCCTTCTACCAC
TCGCTCATCCTCTACGTCCTCTCCTGGCTCATCTGGTCCGGCGACGTCGTCATGGGAGACGGCGCGGCGGCCGGC
CACTGGGTCTGGGGCACGGCTCTCTACGGCGCCGTCCTGCTGACGGTGCTGGGCAAGGCGGCGCTGGTGACGAGC
AACTGGACCAAGTATCACGTCCTCGCCATACCGGGCAGCATGGCCATCTGGTTCGTCTTCATCGCCGCCTACGGC
TCGCTCGCCCCGCTGCTGGGCGTATCGACCGAGTATCGCGGCGTCGTGCCGCGCCTGTTCACCAGCCCCCTGTTC
TGGCTGCAGACGGTCGTCCTGGCGACGCTGTGTCTCGCGCGCGACTTTTGGTGGAAGTACGTCAAGAGGATGTAT
CGCCCACAGACGTACCATCACATCCAGGAGATTCAAAAGTACAACATCCAAGATTACCGCCCAAGAATGGAACAG
TTCCAAAAAGCGATCCGCAAAGTCCGCCAAGTCCAACGCATGCGCAAGCAAAGAGGCTACGCCTTCTCCCAAGCG
GACGAGAGCCAGACGCGCGTCCTGCAGGCCTACGACACGACCAAGAACCGCGGACGCTACGGCGAGATGGCTTCT
TCGAGGCCGGTTTAG
Transcript >Ophcf2|06544
ATGGCTGGTCCTCCTCGACAAGGCGGCGATCCCTCATCGCGTAAGGCCGACGACCTGCTGCTCGACCTCGACGTC
GATCAGCCAGCAGCCTACAACGACGGTCAGCGCTCGACGCTCAACGACGACGATCTTTTACGTCTTCATACCCTT
GACAGCGCCCGCTCGCCGCCTCCATCGTCGTCGCAGCGCCGTCCTTCCGTTTCCTACGACGATTTCGTCGGCGGT
GGGCCCTCGTCGTCTGGCCGCTCGCCCCTGACGCCTCACACGCCTTACCTGGCCAAGCACTACAGTCAGACGTCG
GACCTCGACAACTACCGCCGATACGTCGACGACGAACTCGAAGATTACCCGGATTCGTGTTACCGTCGCGCTTCC
TCCCCCTCAGCCGCCGCCGCCGCCGCCGCCACCGCCGCCGCCGCCGGCCATCAAAACGCCAGGAATCGCAACAGC
GTCCTGAGCCTCGGCGGCGGTCTGCTCGGCAGGGTCAAGAACAAGCTCGGTATGGGAGAGGGCTACTCAGAGATG
GACCTGCCGCTCACCGAGCCCGGTCGAGATCGGTTAGCGGCTGGCTCCGGCGCAAAGGACCACAACAACAAGGCT
TCGTCAAAGTTCGACATGGGCAACTTCAAGTTCGGCTTCGGTCGCTCCAAACCAGACCCTTCCACGCTCGGCCCC
CGTATCGTCCATCTCAACAACCCGCCGGCCAACGCGGCCAACAAGTACGTCGACAATCACATCTCGACGGCAAAG
TACAATTTCGCCACGTTTCTGCCAAAGTTCCTGGTCGAGCAGTTCTCAAAGTTCGCAAACGTCTTCTTCCTCTTC
ACCGCCGGCCTTCAGCAGATCCCGGGCCTGTCGCCGACGAATCGCTACACCACCATCGCCCCTCTCCTCATCGTC
CTCCTCATCTCGGCCGGCAAAGAGCTGGTCGAGGACTACCGCCGCAAGCAGGCCGACAACGCGCTCAACACATCC
AAGGCTCGCGTCCTGCGCGGCTCCGCCTTCACCGAGACCAAATGGATCAACGTCGGCGTCGGCGACGTCGTCCGC
GTCCAGTCCGAAGAGCCCTTCCCCGCCGACCTCGTGCTCCTGGCCAGTTCCGAGCCCGAGGGCCTCTGCTACATC
GAGACGGCCAATCTCGACGGCGAGACCAACCTCAAGATCAAGCAGGCCCTGCCCGAGACGTCGGCCATGGTCTCG
TCGAGCGAGCTCAGCCGGCTCGGCGGGCGCATCAAGTCGGAGCAGCCCAACAGCAGCCTCTACACCTACGAGGCC
ACGCTGACCATGCAGGCCGGAGGCGGCGAGAAGGAGCTGGCCCTCAACCCGGAGCAGCTGCTTCTGAGGGGCGCG
ACGCTGCGCAACACGCCCTGGATCCACGGCGTCGTCGTCTTCACCGGCCACGAGACCAAGCTGATGCGCAACGCC
ACGGCGGCGCCCATCAAGCGGACAAAGGTGGAGCGGCAGCTCAACTGGCTGGTGCTGGTGCTCGTCGGCACGCTG
CTGGTGCTGAGCGTCATCTGCACCATAGGCGACCTGGTCCTTCGCAGCGTCCGGGGCGACGGCCTGCAGTACCTG
TACCTGGACCGCATCGACAGCGCGGCCAAGGTGACGCGGACCTTTGCGCGCGACATGGTGACGTACTGGGTGCTC
TTCTCGTCTCTCGTGCCCATCTCGCTCTTCGTGACGGTGGAGCTGGTCAAGTACTGGCACGGGATCCTCATCAAC
GACGACCTCGACATGTACCACGACAAGACGGACACGCCGGCCACGTGCCGGACCTCGAGCCTGGTGGAGGAGCTG
GGCATGGTCGAGTACGTCTTCTCCGACAAGACGGGCACCCTGACGTGCAACCAGATGGCCTTTAAGCAGTGCACC
ATCGCCGGCGTCCAGTACGCCGACGAGGTGCCCGAGGACCGGCGGGCGGACGACGGCGACGGGGACGGCGTCATG
TACGACTTCGGCCGGCTGCGGGCCAACCTGGCGGGCGGGCACGAGACGGCCGGGGCCATGGACCACTTCCTGACG
CTGCTGGCCATCTGCCACACGGTGATACCCGAGATGACGGACGACGGGGGCGTCAAGTATCAGGCGGCCTCGCCG
GACGAGGGCGCGCTGGTGGCGGGCGCCGTCGAGCTCGGCTACCGCTTCACGGCGCGCAAGCCGCGGTCCGTCATG
ATCGAGGCGGGCGGACGGACGTTGGAGTACGAGCTGCTGGCGGTTTGCGAGTTCAACTCGAGCCGCAAGCGCATG
TCGGCCATCTACCGGTGCCCTGACGGCAAGATCCGATGCTACTGCAAGGGAGCCGACACCGTCATCCTCGAGAGG
CTGGGCGACAAGAACGGTCACGTCGAGGCGACTGTGCGGCACCTGGAGGAGTACGCGTCCGAGGGCCTGCGGACG
CTGTGCCTGGCGATGCGAGAGATAGCCGAGCAGGAGTTTGACGAGTGGTACCGCATCTTCGACGCCGCGGCGACG
ACGGTGGGCGGCAACCGGGCCGACGAGCTCGACAAGGCGGCCGAGATCATCGAGCACGACCTCGTGCTGCTCGGG
GCGACGGCCATCGAGGACCGGCTACAGGACGGGGTGCCCGAGACGATCCACACGCTTCAGCAGGCCAACATCAAG
GTGTGGGTGCTGACGGGGGACCGGCAGGAGACCGCCATCAACATCGGCATGAGCTGCAAGCTGCTGAGCGAGGAC
ATGATGCTGCTCATCGTCAACGAGGAGACGGCCGAGGCCACGGCCGACAACCTGAGCCGCAAGCTCGAGGCGATC
CGGACGCAGGCCGACGGCAGCATCGAGACGGAGACGCTGGCCCTCGTCATCGACGGCAAGTCGCTGACGTACGCC
CTCGAGCGCGACCTGGAGAAGACGTTTCTCGACCTGGCCGTCATGTGCAGGGCCGTCATCTGCTGCAGGGTGTCG
CCGCTGCAAAAGGCGCTGGTGGTGAAGCTGGTCAAGAAATACCGGCGCGAGAGCATCCTGCTGGCCATCGGCGAC
GGGGCCAACGACGTCTCCATGATACAGGCGGCTCACATCGGCGTCGGCATCAGCGGCATGGAGGGACTTCAGGCG
GCCCGGAGCGCGGACGTCGCCATTGCCCAGTTCCGATATCTGCGAAAGCTGCTGCTGGTTCACGGAGCGTGGAGC
TACCAGAGGGTCAGCAAGACGATATTGTTTTCCTTTTACAAGAACATTGCGCTGTACATGACGCAGTTTTGGTAC
ACGTTCCAAAACGTCTTCTCCGGTCAGGTCATCTACGAGTCCTGGACCCTCTCCTTCTACAACGTCTTCTACACC
GTCCTGCCCCCCCTCGCCATCGGCATCCTCGACCAGTTCGTCTCGGCCCGACTGCTGGACCGCTACCCGCAGCTG
TACACCATGGGCCAGAACAACGAATCCTTCAAGCTACGCGTCTTCGCCGAATGGATCGCAAACGCCTTCTACCAC
TCGCTCATCCTCTACGTCCTCTCCTGGCTCATCTGGTCCGGCGACGTCGTCATGGGAGACGGCGCGGCGGCCGGC
CACTGGGTCTGGGGCACGGCTCTCTACGGCGCCGTCCTGCTGACGGTGCTGGGCAAGGCGGCGCTGGTGACGAGC
AACTGGACCAAGTATCACGTCCTCGCCATACCGGGCAGCATGGCCATCTGGTTCGTCTTCATCGCCGCCTACGGC
TCGCTCGCCCCGCTGCTGGGCGTATCGACCGAGTATCGCGGCGTCGTGCCGCGCCTGTTCACCAGCCCCCTGTTC
TGGCTGCAGACGGTCGTCCTGGCGACGCTGTGTCTCGCGCGCGACTTTTGGTGGAAGTACGTCAAGAGGATGTAT
CGCCCACAGACGTACCATCACATCCAGGAGATTCAAAAGTACAACATCCAAGATTACCGCCCAAGAATGGAACAG
TTCCAAAAAGCGATCCGCAAAGTCCGCCAAGTCCAACGCATGCGCAAGCAAAGAGGCTACGCCTTCTCCCAAGCG
GACGAGAGCCAGACGCGCGTCCTGCAGGCCTACGACACGACCAAGAACCGCGGACGCTACGGCGAGATGGCTTCT
TCGAGGCCGGTTTAG
Gene >Ophcf2|06544
ATGGCTGGTCCTCCTCGACAAGGCGGCGATCCCTCATCGCGTAAGGCCGACGACCTGCTGCTCGACCTCGACGTC
GATCAGCCAGCAGCCTACAACGACGGTCAGCGCTCGACGCTCAACGACGACGATCTTTTACGTCTTCATACCCTT
GACAGCGCCCGCTCGCCGCCTCCATCGTCGTCGCAGCGCCGTCCTTCCGTTTCCTACGACGATTTCGTCGGCGGT
GGGCCCTCGTCGTCTGGCCGCTCGCCCCTGACGCCTCACACGCCTTACCTGGCCAAGCACTACAGTCAGACGTCG
GACCTCGACAACTACCGCCGATACGTCGACGACGAACTCGAAGATTACCCGGATTCGTGTTACCGTCGCGCTTCC
TCCCCCTCAGCCGCCGCCGCCGCCGCCGCCACCGCCGCCGCCGCCGGCCATCAAAACGCCAGGAATCGCAACAGC
GTCCTGAGCCTCGGCGGCGGTCTGCTCGGCAGGGTCAAGAACAAGCTCGGTATGGGAGAGGGCTACTCAGAGATG
GACCTGCCGCTCACCGAGCCCGGTCGAGATCGGTTAGCGGCTGGCTCCGGCGCAAAGGACCACAACAACAAGGCT
TCGTCAAAGTTCGACATGGGCAACTTCAAGTTCGGCTTCGGTCGCTCCAAACCAGACCCTTCCACGCTCGGCCCC
CGTATCGTCCATCTCAACAACCCGCCGGCCAACGCGGCCAACAAGTACGTCGACAATCACATCTCGACGGCAAAG
TACAATTTCGCCACGTTTCTGCCAAAGTTCCTGGTCGAGCAGTTCTCAAAGTTCGCAAACGTCTTCTTCCTCTTC
ACCGCCGGCCTTCAGCAGATCCCGGGCCTGTCGCCGACGAATCGCTACACCACCATCGCCCCTCTCCTCATCGTC
CTCCTCATCTCGGCCGGCAAAGAGCTGGTCGAGGACTACCGCCGCAAGCAGGCCGACAACGCGCTCAACACATCC
AAGGCTCGCGTCCTGCGCGGCTCCGCCTTCACCGAGACCAAATGGATCAACGTCGGCGTCGGCGACGTCGTCCGC
GTCCAGTCCGAAGAGCCCTTCCCCGCCGACCTCGTGCTCCTGGCCAGTTCCGAGCCCGAGGGCCTCTGCTACATC
GAGACGGCCAATCTCGACGGCGAGACCAACCTCAAGATCAAGCAGGCCCTGCCCGAGACGTCGGCCATGGTCTCG
TCGAGCGAGCTCAGCCGGCTCGGCGGGCGCATCAAGTCGGAGCAGCCCAACAGCAGCCTCTACACCTACGAGGCC
ACGCTGACCATGCAGGCCGGAGGCGGCGAGAAGGAGCTGGCCCTCAACCCGGAGCAGCTGCTTCTGAGGGGCGCG
ACGCTGCGCAACACGCCCTGGATCCACGGCGTCGTCGTCTTCACCGGCCACGAGACCAAGCTGATGCGCAACGCC
ACGGCGGCGCCCATCAAGCGGACAAAGGTGGAGCGGCAGCTCAACTGGCTGGTGCTGGTGCTCGTCGGCACGCTG
CTGGTGCTGAGCGTCATCTGCACCATAGGCGACCTGGTCCTTCGCAGCGTCCGGGGCGACGGCCTGCAGTACCTG
TACCTGGACCGCATCGACAGCGCGGCCAAGGTGACGCGGACCTTTGCGCGCGACATGGTGACGTACTGGGTGCTC
TTCTCGTCTCTCGTGCCCATCTCGCTCTTCGTGACGGTGGAGCTGGTCAAGTACTGGCACGGGATCCTCATCAAC
GACGACCTCGACATGTACCACGACAAGACGGACACGCCGGCCACGTGCCGGACCTCGAGCCTGGTGGAGGAGCTG
GGCATGGTCGAGTACGTCTTCTCCGACAAGACGGGCACCCTGACGTGCAACCAGATGGCCTTTAAGCAGTGCACC
ATCGCCGGCGTCCAGTACGCCGACGAGGTGCCCGAGGACCGGCGGGCGGACGACGGCGACGGGGACGGCGTCATG
TACGACTTCGGCCGGCTGCGGGCCAACCTGGCGGGCGGGCACGAGACGGCCGGGGCCATGGACCACTTCCTGACG
CTGCTGGCCATCTGCCACACGGTGATACCCGAGATGACGGACGACGGGGGCGTCAAGTATCAGGCGGCCTCGCCG
GACGAGGGCGCGCTGGTGGCGGGCGCCGTCGAGCTCGGCTACCGCTTCACGGCGCGCAAGCCGCGGTCCGTCATG
ATCGAGGCGGGCGGACGGACGTTGGAGTACGAGCTGCTGGCGGTTTGCGAGTTCAACTCGAGCCGCAAGCGCATG
TCGGCCATCTACCGGTGCCCTGACGGCAAGATCCGATGCTACTGCAAGGGAGCCGACACCGTCATCCTCGAGAGG
CTGGGCGACAAGAACGGTCACGTCGAGGCGACTGTGCGGCACCTGGAGGAGTACGCGTCCGAGGGCCTGCGGACG
CTGTGCCTGGCGATGCGAGAGATAGCCGAGCAGGAGTTTGACGAGTGGTACCGCATCTTCGACGCCGCGGCGACG
ACGGTGGGCGGCAACCGGGCCGACGAGCTCGACAAGGCGGCCGAGATCATCGAGCACGACCTCGTGCTGCTCGGG
GCGACGGCCATCGAGGACCGGCTACAGGACGGGGTGCCCGAGACGATCCACACGCTTCAGCAGGCCAACATCAAG
GTGTGGGTGCTGACGGGGGACCGGCAGGAGACCGCCATCAACATCGGCATGAGCTGCAAGCTGCTGAGCGAGGAC
ATGATGCTGCTCATCGTCAACGAGGAGACGGCCGAGGCCACGGCCGACAACCTGAGCCGCAAGCTCGAGGCGATC
CGGACGCAGGCCGACGGCAGCATCGAGACGGAGACGCTGGCCCTCGTCATCGACGGCAAGTCGCTGACGTACGCC
CTCGAGCGCGACCTGGAGAAGACGTTTCTCGACCTGGCCGTCATGTGCAGGGCCGTCATCTGCTGCAGGGTGTCG
CCGCTGCAAAAGGCGCTGGTGGTGAAGCTGGTCAAGAAATACCGGCGCGAGAGCATCCTGCTGGCCATCGGCGAC
GGGGCCAACGACGTCTCCATGATACAGGCGGCTCACATCGGCGTCGGCATCAGCGGCATGGAGGGACTTCAGGCG
GCCCGGAGCGCGGACGTCGCCATTGCCCAGTTCCGATATCTGCGAAAGCTGCTGCTGGTTCACGGAGCGTGGAGC
TACCAGAGGGTCAGCAAGACGATATTGTTTTCCTTTTACAAGAACATTGCGCTGTACATGACGCAGTTTTGGGTA
TTGATCTCTTTTCTCTTCTCTTCTCTTCTCTTCTCTTCTCTTCCCCTTCCCCTTTCCCCTTTCCCCTTACCCCCT
TCTTGCCTCTCACCATCTGACAAGAGATCAAGTACACGTTCCAAAACGTCTTCTCCGGTCAGGTCATCTACGAGT
CCTGGACCCTCTCCTTCTACAACGTCTTCTACACCGTCCTGCCCCCCCTCGCCATCGGCATCCTCGACCAGTTCG
TCTCGGCCCGACTGCTGGACCGCTACCCGCAGCTGTACACCATGGGCCAGAACAACGAATCCTTCAAGCTACGCG
TCTTCGCCGAATGGATCGCAAACGCCTTCTACCACTCGCTCATCCTCTACGTCCTCTCCTGGCTCATCTGGTCCG
GCGACGTCGTCATGGGAGACGGCGCGGCGGCCGGCCACTGGGTCTGGGGCACGGCTCTCTACGGCGCCGTCCTGC
TGACGGTGCTGGGCAAGGCGGCGCTGGTGACGAGCAACTGGACCAAGTATCACGTCCTCGCCATACCGGGCAGCA
TGGCCATCTGGTTCGTCTTCATCGCCGCCTACGGCTCGCTCGCCCCGCTGCTGGGCGTATCGACCGAGTATCGCG
GCGTCGTGCCGCGCCTGTTCACCAGCCCCCTGTTCTGGCTGCAGACGGTCGTCCTGGCGACGCTGTGTCTCGCGC
GCGACTTTTGGTGGAAGTACGTCAAGAGGATGTATCGCCCACAGACGTACCATCACATCCAGGAGATTCAAAAGT
ACAACATCCAAGATTACCGCCCAAGGTTCGTCCGCCTCCCGTCCTTGTGCCTGCCTTGGCCCCCGAAATCTTAAC
AAGAAGCCCCCCCCCCCCCAGAATGGAACAGTTCCAAAAAGCGATCCGCAAAGTCCGCCAAGTCCAACGCATGCG
CAAGCAAAGAGGCTACGCCTTCTCCCAAGCGGACGAGAGCCAGACGCGCGTCCTGCAGGCCTACGACACGACCAA
GAACCGCGGACGCTACGGCGAGATGGCTTCTTCGAGGCCGGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail