Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06537
Gene name
Locationscaffold_08:382619..384007
Strand-
Gene length (bp)1388
Transcript length (bp)1329
Coding sequence length (bp)1329
Protein length (aa) 443

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07946 CCDC47 PAT complex subunit CCDC47 5.0E-109 84 433

GO

GO Term Description Terminal node
GO:0032469 endoplasmic reticulum calcium ion homeostasis Yes
GO:0005509 calcium ion binding Yes
GO:0005783 endoplasmic reticulum Yes
GO:0043229 intracellular organelle No
GO:0043226 organelle No
GO:0005575 cellular_component No
GO:0019725 cellular homeostasis No
GO:0072507 divalent inorganic cation homeostasis No
GO:0006874 cellular calcium ion homeostasis No
GO:0005488 binding No
GO:0043169 cation binding No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:0006875 cellular metal ion homeostasis No
GO:0009987 cellular process No
GO:0065008 regulation of biological quality No
GO:0055065 metal ion homeostasis No
GO:0030003 cellular cation homeostasis No
GO:0072503 cellular divalent inorganic cation homeostasis No
GO:0046872 metal ion binding No
GO:0006873 cellular ion homeostasis No
GO:0003674 molecular_function No
GO:0048878 chemical homeostasis No
GO:0098771 inorganic ion homeostasis No
GO:0042592 homeostatic process No
GO:0110165 cellular anatomical entity No
GO:0065007 biological regulation No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0055074 calcium ion homeostasis No
GO:0055080 cation homeostasis No
GO:0055082 cellular chemical homeostasis No
GO:0050801 ion homeostasis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 89 108 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 145.28 80.63 209.93
Alive In ants, during behavior modification 100.49 56.84 144.13
Dead In ants, recently dead 137.06 76.14 197.98

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.046411 yes
Alive Dead 0.060112 no
Dead Fungus 0.805139 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06537
MAQRLLQSLFGGNQPPAPAAKPLDADFADFAADSAGAPEAAPEAVPEPGPGKATLTAAAAAASPTGQQPWTKWYR
VQDRHSLSEFKAEGVILAIVALMLVLHVLGARVNRAKARAWMRANAAVLRSEFALVGFGDVPTMDRDDVIADGLL
RENSLFEFATYATGRQNAAFMDVKLTLAKRFNPVLSSIEAVAAVFSEMFAPPADVLEAVLYPFDGKEELTVPKPP
GEDSRKDSRSTYEGFVWAIVHKDRMQKLREERYDVTLASTRDNAKLPAWLTVMSESPEITDALLTKELTAAVTAA
GDAFEYVIVSDQPVDKPKTMEETTPRKRLFLRYRLPSSDDYKALTALLTCFARLPDVLVQSARFRPEVMRKVRAT
REAMMAQLKKAHDEERNEERLAEKEKSRKAKRDAELKGLDAKAQKKYLEKEREKEMRRNQKKMTMRG*
Coding >Ophcf2|06537
ATGGCCCAGCGCCTTCTGCAGAGCCTCTTCGGTGGCAACCAGCCCCCTGCTCCGGCAGCCAAGCCGCTCGACGCC
GACTTTGCCGACTTCGCCGCAGACTCGGCAGGCGCTCCGGAAGCAGCGCCGGAAGCTGTGCCGGAGCCCGGTCCC
GGAAAGGCGACTCTCACCGCTGCCGCCGCCGCAGCCTCGCCGACGGGTCAGCAGCCATGGACGAAGTGGTATAGG
GTACAGGACCGGCACTCGCTATCCGAGTTCAAGGCAGAGGGCGTCATCCTCGCCATCGTGGCTCTCATGCTGGTG
CTGCACGTGTTGGGCGCACGCGTCAACCGGGCCAAGGCCAGGGCGTGGATGCGGGCCAACGCGGCGGTTTTACGA
TCCGAATTCGCCCTCGTCGGCTTCGGAGATGTGCCGACCATGGACAGGGATGATGTTATCGCCGACGGGCTACTC
CGTGAGAATTCGCTATTCGAGTTCGCGACGTATGCGACGGGGCGACAGAACGCGGCCTTTATGGACGTCAAGCTC
ACGCTGGCCAAGCGTTTCAATCCAGTCCTCAGCTCCATCGAGGCCGTCGCCGCCGTCTTTTCCGAAATGTTCGCC
CCTCCAGCCGACGTGTTGGAGGCGGTGCTGTATCCCTTTGACGGAAAGGAAGAGCTGACGGTTCCGAAGCCGCCT
GGCGAAGACAGTCGCAAGGACTCGCGCAGCACGTACGAGGGCTTCGTCTGGGCCATTGTCCACAAAGACCGGATG
CAAAAGCTGCGCGAGGAACGGTACGACGTGACGCTCGCTTCTACCAGGGACAACGCCAAGCTACCAGCCTGGCTG
ACGGTCATGAGCGAGAGCCCCGAAATCACAGACGCGCTCCTAACCAAGGAGTTGACGGCGGCGGTGACGGCGGCC
GGTGACGCGTTCGAATACGTCATCGTAAGCGATCAGCCCGTCGACAAGCCAAAGACGATGGAAGAGACGACGCCG
CGCAAGCGTCTCTTCCTCCGCTACCGACTCCCCAGTTCAGACGACTACAAGGCGCTGACGGCGCTCCTCACATGC
TTCGCCCGTCTCCCCGACGTGCTAGTCCAGTCAGCGCGATTCCGACCCGAGGTCATGCGCAAGGTGCGCGCCACG
CGAGAAGCCATGATGGCGCAGCTCAAGAAGGCGCACGACGAGGAGCGCAACGAGGAGCGACTGGCAGAGAAGGAA
AAGTCTCGCAAGGCCAAGCGCGATGCTGAGCTCAAGGGCTTGGACGCCAAGGCGCAGAAGAAATATCTGGAGAAG
GAGAGGGAGAAGGAGATGCGGAGGAATCAGAAGAAGATGACGATGCGAGGCTGA
Transcript >Ophcf2|06537
ATGGCCCAGCGCCTTCTGCAGAGCCTCTTCGGTGGCAACCAGCCCCCTGCTCCGGCAGCCAAGCCGCTCGACGCC
GACTTTGCCGACTTCGCCGCAGACTCGGCAGGCGCTCCGGAAGCAGCGCCGGAAGCTGTGCCGGAGCCCGGTCCC
GGAAAGGCGACTCTCACCGCTGCCGCCGCCGCAGCCTCGCCGACGGGTCAGCAGCCATGGACGAAGTGGTATAGG
GTACAGGACCGGCACTCGCTATCCGAGTTCAAGGCAGAGGGCGTCATCCTCGCCATCGTGGCTCTCATGCTGGTG
CTGCACGTGTTGGGCGCACGCGTCAACCGGGCCAAGGCCAGGGCGTGGATGCGGGCCAACGCGGCGGTTTTACGA
TCCGAATTCGCCCTCGTCGGCTTCGGAGATGTGCCGACCATGGACAGGGATGATGTTATCGCCGACGGGCTACTC
CGTGAGAATTCGCTATTCGAGTTCGCGACGTATGCGACGGGGCGACAGAACGCGGCCTTTATGGACGTCAAGCTC
ACGCTGGCCAAGCGTTTCAATCCAGTCCTCAGCTCCATCGAGGCCGTCGCCGCCGTCTTTTCCGAAATGTTCGCC
CCTCCAGCCGACGTGTTGGAGGCGGTGCTGTATCCCTTTGACGGAAAGGAAGAGCTGACGGTTCCGAAGCCGCCT
GGCGAAGACAGTCGCAAGGACTCGCGCAGCACGTACGAGGGCTTCGTCTGGGCCATTGTCCACAAAGACCGGATG
CAAAAGCTGCGCGAGGAACGGTACGACGTGACGCTCGCTTCTACCAGGGACAACGCCAAGCTACCAGCCTGGCTG
ACGGTCATGAGCGAGAGCCCCGAAATCACAGACGCGCTCCTAACCAAGGAGTTGACGGCGGCGGTGACGGCGGCC
GGTGACGCGTTCGAATACGTCATCGTAAGCGATCAGCCCGTCGACAAGCCAAAGACGATGGAAGAGACGACGCCG
CGCAAGCGTCTCTTCCTCCGCTACCGACTCCCCAGTTCAGACGACTACAAGGCGCTGACGGCGCTCCTCACATGC
TTCGCCCGTCTCCCCGACGTGCTAGTCCAGTCAGCGCGATTCCGACCCGAGGTCATGCGCAAGGTGCGCGCCACG
CGAGAAGCCATGATGGCGCAGCTCAAGAAGGCGCACGACGAGGAGCGCAACGAGGAGCGACTGGCAGAGAAGGAA
AAGTCTCGCAAGGCCAAGCGCGATGCTGAGCTCAAGGGCTTGGACGCCAAGGCGCAGAAGAAATATCTGGAGAAG
GAGAGGGAGAAGGAGATGCGGAGGAATCAGAAGAAGATGACGATGCGAGGCTGA
Gene >Ophcf2|06537
ATGGCCCAGCGCCTTCTGCAGAGCCTCTTCGGTGGCAACCAGCCCCCTGCTCCGGCAGCCAAGCCGCTCGACGCC
GGTAAAGCTTTGCGAACCCCTCCCTCTCCCCCTCCCTCTCGTCTCACTGATCTCTGTTAGACTTTGCCGACTTCG
CCGCAGACTCGGCAGGCGCTCCGGAAGCAGCGCCGGAAGCTGTGCCGGAGCCCGGTCCCGGAAAGGCGACTCTCA
CCGCTGCCGCCGCCGCAGCCTCGCCGACGGGTCAGCAGCCATGGACGAAGTGGTATAGGGTACAGGACCGGCACT
CGCTATCCGAGTTCAAGGCAGAGGGCGTCATCCTCGCCATCGTGGCTCTCATGCTGGTGCTGCACGTGTTGGGCG
CACGCGTCAACCGGGCCAAGGCCAGGGCGTGGATGCGGGCCAACGCGGCGGTTTTACGATCCGAATTCGCCCTCG
TCGGCTTCGGAGATGTGCCGACCATGGACAGGGATGATGTTATCGCCGACGGGCTACTCCGTGAGAATTCGCTAT
TCGAGTTCGCGACGTATGCGACGGGGCGACAGAACGCGGCCTTTATGGACGTCAAGCTCACGCTGGCCAAGCGTT
TCAATCCAGTCCTCAGCTCCATCGAGGCCGTCGCCGCCGTCTTTTCCGAAATGTTCGCCCCTCCAGCCGACGTGT
TGGAGGCGGTGCTGTATCCCTTTGACGGAAAGGAAGAGCTGACGGTTCCGAAGCCGCCTGGCGAAGACAGTCGCA
AGGACTCGCGCAGCACGTACGAGGGCTTCGTCTGGGCCATTGTCCACAAAGACCGGATGCAAAAGCTGCGCGAGG
AACGGTACGACGTGACGCTCGCTTCTACCAGGGACAACGCCAAGCTACCAGCCTGGCTGACGGTCATGAGCGAGA
GCCCCGAAATCACAGACGCGCTCCTAACCAAGGAGTTGACGGCGGCGGTGACGGCGGCCGGTGACGCGTTCGAAT
ACGTCATCGTAAGCGATCAGCCCGTCGACAAGCCAAAGACGATGGAAGAGACGACGCCGCGCAAGCGTCTCTTCC
TCCGCTACCGACTCCCCAGTTCAGACGACTACAAGGCGCTGACGGCGCTCCTCACATGCTTCGCCCGTCTCCCCG
ACGTGCTAGTCCAGTCAGCGCGATTCCGACCCGAGGTCATGCGCAAGGTGCGCGCCACGCGAGAAGCCATGATGG
CGCAGCTCAAGAAGGCGCACGACGAGGAGCGCAACGAGGAGCGACTGGCAGAGAAGGAAAAGTCTCGCAAGGCCA
AGCGCGATGCTGAGCTCAAGGGCTTGGACGCCAAGGCGCAGAAGAAATATCTGGAGAAGGAGAGGGAGAAGGAGA
TGCGGAGGAATCAGAAGAAGATGACGATGCGAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail