Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06537
Gene name
Locationscaffold_08:382619..384007
Strand-
Gene length (bp)1388
Transcript length (bp)1329
Coding sequence length (bp)1329
Protein length (aa) 443

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07946 CCDC47 PAT complex subunit CCDC47 5.0E-109 84 433

GO

GO Term Description Terminal node
GO:0032469 endoplasmic reticulum calcium ion homeostasis Yes
GO:0005509 calcium ion binding Yes
GO:0005783 endoplasmic reticulum Yes
GO:0043229 intracellular organelle No
GO:0043226 organelle No
GO:0005575 cellular_component No
GO:0019725 cellular homeostasis No
GO:0072507 divalent inorganic cation homeostasis No
GO:0006874 cellular calcium ion homeostasis No
GO:0005488 binding No
GO:0043169 cation binding No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:0006875 cellular metal ion homeostasis No
GO:0009987 cellular process No
GO:0065008 regulation of biological quality No
GO:0055065 metal ion homeostasis No
GO:0030003 cellular cation homeostasis No
GO:0072503 cellular divalent inorganic cation homeostasis No
GO:0046872 metal ion binding No
GO:0006873 cellular ion homeostasis No
GO:0003674 molecular_function No
GO:0048878 chemical homeostasis No
GO:0098771 inorganic ion homeostasis No
GO:0042592 homeostatic process No
GO:0110165 cellular anatomical entity No
GO:0065007 biological regulation No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0055074 calcium ion homeostasis No
GO:0055080 cation homeostasis No
GO:0055082 cellular chemical homeostasis No
GO:0050801 ion homeostasis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 89 108 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06537
MAQRLLQSLFGGNQPPAPAAKPLDADFADFAADSAGAPEAAPEAVPEPGPGKATLTAAAAAASPTGQQPWTKWYR
VQDRHSLSEFKAEGVILAIVALMLVLHVLGARVNRAKARAWMRANAAVLRSEFALVGFGDVPTMDRDDVIADGLL
RENSLFEFATYATGRQNAAFMDVKLTLAKRFNPVLSSIEAVAAVFSEMFAPPADVLEAVLYPFDGKEELTVPKPP
GEDSRKDSRSTYEGFVWAIVHKDRMQKLREERYDVTLASTRDNAKLPAWLTVMSESPEITDALLTKELTAAVTAA
GDAFEYVIVSDQPVDKPKTMEETTPRKRLFLRYRLPSSDDYKALTALLTCFARLPDVLVQSARFRPEVMRKVRAT
REAMMAQLKKAHDEERNEERLAEKEKSRKAKRDAELKGLDAKAQKKYLEKEREKEMRRNQKKMTMRG*
Coding >Ophcf2|06537
ATGGCCCAGCGCCTTCTGCAGAGCCTCTTCGGTGGCAACCAGCCCCCTGCTCCGGCAGCCAAGCCGCTCGACGCC
GACTTTGCCGACTTCGCCGCAGACTCGGCAGGCGCTCCGGAAGCAGCGCCGGAAGCTGTGCCGGAGCCCGGTCCC
GGAAAGGCGACTCTCACCGCTGCCGCCGCCGCAGCCTCGCCGACGGGTCAGCAGCCATGGACGAAGTGGTATAGG
GTACAGGACCGGCACTCGCTATCCGAGTTCAAGGCAGAGGGCGTCATCCTCGCCATCGTGGCTCTCATGCTGGTG
CTGCACGTGTTGGGCGCACGCGTCAACCGGGCCAAGGCCAGGGCGTGGATGCGGGCCAACGCGGCGGTTTTACGA
TCCGAATTCGCCCTCGTCGGCTTCGGAGATGTGCCGACCATGGACAGGGATGATGTTATCGCCGACGGGCTACTC
CGTGAGAATTCGCTATTCGAGTTCGCGACGTATGCGACGGGGCGACAGAACGCGGCCTTTATGGACGTCAAGCTC
ACGCTGGCCAAGCGTTTCAATCCAGTCCTCAGCTCCATCGAGGCCGTCGCCGCCGTCTTTTCCGAAATGTTCGCC
CCTCCAGCCGACGTGTTGGAGGCGGTGCTGTATCCCTTTGACGGAAAGGAAGAGCTGACGGTTCCGAAGCCGCCT
GGCGAAGACAGTCGCAAGGACTCGCGCAGCACGTACGAGGGCTTCGTCTGGGCCATTGTCCACAAAGACCGGATG
CAAAAGCTGCGCGAGGAACGGTACGACGTGACGCTCGCTTCTACCAGGGACAACGCCAAGCTACCAGCCTGGCTG
ACGGTCATGAGCGAGAGCCCCGAAATCACAGACGCGCTCCTAACCAAGGAGTTGACGGCGGCGGTGACGGCGGCC
GGTGACGCGTTCGAATACGTCATCGTAAGCGATCAGCCCGTCGACAAGCCAAAGACGATGGAAGAGACGACGCCG
CGCAAGCGTCTCTTCCTCCGCTACCGACTCCCCAGTTCAGACGACTACAAGGCGCTGACGGCGCTCCTCACATGC
TTCGCCCGTCTCCCCGACGTGCTAGTCCAGTCAGCGCGATTCCGACCCGAGGTCATGCGCAAGGTGCGCGCCACG
CGAGAAGCCATGATGGCGCAGCTCAAGAAGGCGCACGACGAGGAGCGCAACGAGGAGCGACTGGCAGAGAAGGAA
AAGTCTCGCAAGGCCAAGCGCGATGCTGAGCTCAAGGGCTTGGACGCCAAGGCGCAGAAGAAATATCTGGAGAAG
GAGAGGGAGAAGGAGATGCGGAGGAATCAGAAGAAGATGACGATGCGAGGCTGA
Transcript >Ophcf2|06537
ATGGCCCAGCGCCTTCTGCAGAGCCTCTTCGGTGGCAACCAGCCCCCTGCTCCGGCAGCCAAGCCGCTCGACGCC
GACTTTGCCGACTTCGCCGCAGACTCGGCAGGCGCTCCGGAAGCAGCGCCGGAAGCTGTGCCGGAGCCCGGTCCC
GGAAAGGCGACTCTCACCGCTGCCGCCGCCGCAGCCTCGCCGACGGGTCAGCAGCCATGGACGAAGTGGTATAGG
GTACAGGACCGGCACTCGCTATCCGAGTTCAAGGCAGAGGGCGTCATCCTCGCCATCGTGGCTCTCATGCTGGTG
CTGCACGTGTTGGGCGCACGCGTCAACCGGGCCAAGGCCAGGGCGTGGATGCGGGCCAACGCGGCGGTTTTACGA
TCCGAATTCGCCCTCGTCGGCTTCGGAGATGTGCCGACCATGGACAGGGATGATGTTATCGCCGACGGGCTACTC
CGTGAGAATTCGCTATTCGAGTTCGCGACGTATGCGACGGGGCGACAGAACGCGGCCTTTATGGACGTCAAGCTC
ACGCTGGCCAAGCGTTTCAATCCAGTCCTCAGCTCCATCGAGGCCGTCGCCGCCGTCTTTTCCGAAATGTTCGCC
CCTCCAGCCGACGTGTTGGAGGCGGTGCTGTATCCCTTTGACGGAAAGGAAGAGCTGACGGTTCCGAAGCCGCCT
GGCGAAGACAGTCGCAAGGACTCGCGCAGCACGTACGAGGGCTTCGTCTGGGCCATTGTCCACAAAGACCGGATG
CAAAAGCTGCGCGAGGAACGGTACGACGTGACGCTCGCTTCTACCAGGGACAACGCCAAGCTACCAGCCTGGCTG
ACGGTCATGAGCGAGAGCCCCGAAATCACAGACGCGCTCCTAACCAAGGAGTTGACGGCGGCGGTGACGGCGGCC
GGTGACGCGTTCGAATACGTCATCGTAAGCGATCAGCCCGTCGACAAGCCAAAGACGATGGAAGAGACGACGCCG
CGCAAGCGTCTCTTCCTCCGCTACCGACTCCCCAGTTCAGACGACTACAAGGCGCTGACGGCGCTCCTCACATGC
TTCGCCCGTCTCCCCGACGTGCTAGTCCAGTCAGCGCGATTCCGACCCGAGGTCATGCGCAAGGTGCGCGCCACG
CGAGAAGCCATGATGGCGCAGCTCAAGAAGGCGCACGACGAGGAGCGCAACGAGGAGCGACTGGCAGAGAAGGAA
AAGTCTCGCAAGGCCAAGCGCGATGCTGAGCTCAAGGGCTTGGACGCCAAGGCGCAGAAGAAATATCTGGAGAAG
GAGAGGGAGAAGGAGATGCGGAGGAATCAGAAGAAGATGACGATGCGAGGCTGA
Gene >Ophcf2|06537
ATGGCCCAGCGCCTTCTGCAGAGCCTCTTCGGTGGCAACCAGCCCCCTGCTCCGGCAGCCAAGCCGCTCGACGCC
GGTAAAGCTTTGCGAACCCCTCCCTCTCCCCCTCCCTCTCGTCTCACTGATCTCTGTTAGACTTTGCCGACTTCG
CCGCAGACTCGGCAGGCGCTCCGGAAGCAGCGCCGGAAGCTGTGCCGGAGCCCGGTCCCGGAAAGGCGACTCTCA
CCGCTGCCGCCGCCGCAGCCTCGCCGACGGGTCAGCAGCCATGGACGAAGTGGTATAGGGTACAGGACCGGCACT
CGCTATCCGAGTTCAAGGCAGAGGGCGTCATCCTCGCCATCGTGGCTCTCATGCTGGTGCTGCACGTGTTGGGCG
CACGCGTCAACCGGGCCAAGGCCAGGGCGTGGATGCGGGCCAACGCGGCGGTTTTACGATCCGAATTCGCCCTCG
TCGGCTTCGGAGATGTGCCGACCATGGACAGGGATGATGTTATCGCCGACGGGCTACTCCGTGAGAATTCGCTAT
TCGAGTTCGCGACGTATGCGACGGGGCGACAGAACGCGGCCTTTATGGACGTCAAGCTCACGCTGGCCAAGCGTT
TCAATCCAGTCCTCAGCTCCATCGAGGCCGTCGCCGCCGTCTTTTCCGAAATGTTCGCCCCTCCAGCCGACGTGT
TGGAGGCGGTGCTGTATCCCTTTGACGGAAAGGAAGAGCTGACGGTTCCGAAGCCGCCTGGCGAAGACAGTCGCA
AGGACTCGCGCAGCACGTACGAGGGCTTCGTCTGGGCCATTGTCCACAAAGACCGGATGCAAAAGCTGCGCGAGG
AACGGTACGACGTGACGCTCGCTTCTACCAGGGACAACGCCAAGCTACCAGCCTGGCTGACGGTCATGAGCGAGA
GCCCCGAAATCACAGACGCGCTCCTAACCAAGGAGTTGACGGCGGCGGTGACGGCGGCCGGTGACGCGTTCGAAT
ACGTCATCGTAAGCGATCAGCCCGTCGACAAGCCAAAGACGATGGAAGAGACGACGCCGCGCAAGCGTCTCTTCC
TCCGCTACCGACTCCCCAGTTCAGACGACTACAAGGCGCTGACGGCGCTCCTCACATGCTTCGCCCGTCTCCCCG
ACGTGCTAGTCCAGTCAGCGCGATTCCGACCCGAGGTCATGCGCAAGGTGCGCGCCACGCGAGAAGCCATGATGG
CGCAGCTCAAGAAGGCGCACGACGAGGAGCGCAACGAGGAGCGACTGGCAGAGAAGGAAAAGTCTCGCAAGGCCA
AGCGCGATGCTGAGCTCAAGGGCTTGGACGCCAAGGCGCAGAAGAAATATCTGGAGAAGGAGAGGGAGAAGGAGA
TGCGGAGGAATCAGAAGAAGATGACGATGCGAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail