Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06535
Gene name
Locationscaffold_08:378329..380023
Strand+
Gene length (bp)1694
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03234 CDC37_N Cdc37 N terminal kinase binding 7.4E-49 2 139
PF08565 CDC37_M Cdc37 Hsp90 binding domain 5.6E-38 243 352
PF08564 CDC37_C Cdc37 C terminal domain 6.1E-29 378 469

GO

GO Term Description Terminal node
GO:0019901 protein kinase binding Yes
GO:0019899 enzyme binding No
GO:0019900 kinase binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0005515 protein binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5856 0.7139 0.0717 0.041 0.2225 0.0066 0.1043 0.0286 0.0349 0.0079

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1880
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4287
Ophiocordyceps australis map64 (Brazil) OphauB2|5187
Ophiocordyceps camponoti-floridani Ophcf2|06535 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5669
Ophiocordyceps kimflemingae Ophio5|3217
Ophiocordyceps subramaniannii Hirsu2|1924

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06535
MPVDYSKWDALELSDDSDIEVHPNVDKRSFIRAKQNQIHQDRLQRKHRIETLKYERIINDGLLKRISSLLAALKG
HASEAATRNPGEMAFQAVMESTGDAKEDQPPPPPEGVHSEVGERPTYSKMMAVLLDQVNKALDEKKAQDRYGAMM
DEIRGHEEKVAKLQGELLAKLRELEKEDGKKITSADIHTGFDSSHVNKSKTPAESSSSGQSTTQVELLNPQVQKG
DDKSGDDPEAEASPDAKKFAQIKANDYTTSLRFLAQHPHILTERDSDGILVLAFDAGLEGDDDGCRRCVHQGLLL
QYCRALGKDGVGLFFKRITTKGHQAQDVFYRDVQDTYTRIRKRSREIVAERAADPEGEEVAQIQLHAVEPGTAIQ
IRVPDADAMEPEARRARDIFDGFRPELREALASGGLDEVNRVLGGMKVEEAEEVVDLLGEANILSLEEQLIDATT
DEGKKQLEAMEAEAAAAAAAATKSDDGA*
Coding >Ophcf2|06535
ATGCCCGTCGACTACAGTAAATGGGACGCGCTGGAGCTCAGCGACGACTCGGACATCGAAGTGCACCCCAACGTC
GACAAGCGATCCTTCATACGAGCCAAGCAGAATCAGATCCATCAAGACCGGCTCCAGCGGAAGCACCGGATCGAG
ACGCTCAAGTATGAGCGCATAATCAACGACGGCCTGCTGAAGCGCATCTCGTCCCTGCTCGCGGCGCTGAAAGGC
CATGCGTCCGAGGCAGCGACGCGGAACCCGGGCGAGATGGCCTTTCAGGCCGTCATGGAGTCGACCGGAGACGCC
AAAGAGGATCAGCCTCCGCCGCCGCCGGAGGGTGTGCACTCGGAGGTCGGGGAGCGGCCGACGTACTCCAAGATG
ATGGCGGTGCTGCTGGACCAGGTGAACAAGGCGCTGGACGAGAAGAAGGCGCAGGACCGATACGGCGCCATGATG
GACGAGATCCGGGGTCACGAGGAAAAGGTGGCCAAACTTCAGGGCGAACTGCTGGCCAAGCTGCGAGAGCTGGAG
AAGGAGGACGGCAAGAAGATTACCAGCGCCGACATTCATACGGGCTTTGACAGTTCCCACGTCAACAAATCAAAG
ACACCGGCCGAGAGCAGCAGCAGCGGCCAGTCGACGACTCAGGTTGAGCTCCTCAACCCGCAGGTGCAAAAGGGC
GACGACAAGAGCGGCGATGACCCGGAGGCCGAGGCGTCACCCGACGCCAAGAAGTTTGCGCAGATCAAGGCCAAC
GACTACACGACCAGCCTCCGCTTCCTGGCACAGCACCCACACATCCTGACGGAGCGCGACTCGGACGGCATCCTG
GTGCTGGCCTTTGACGCGGGGCTGGAAGGCGATGACGACGGGTGCCGACGATGTGTGCACCAGGGCCTGCTACTG
CAATACTGCCGCGCGCTCGGCAAGGACGGCGTCGGCCTCTTCTTCAAGCGCATCACGACAAAGGGCCACCAAGCG
CAGGATGTCTTCTACCGCGACGTGCAAGACACTTACACCCGGATCAGGAAGCGGTCTCGCGAGATTGTAGCCGAG
CGGGCGGCCGACCCCGAGGGCGAAGAGGTGGCGCAGATCCAGCTGCACGCCGTGGAACCGGGGACGGCCATCCAG
ATCCGCGTGCCGGACGCGGACGCCATGGAGCCTGAGGCGCGGAGGGCGCGAGACATCTTTGATGGCTTTCGGCCC
GAGTTGAGGGAGGCCTTGGCTTCGGGGGGGTTGGATGAGGTGAATCGGGTGCTGGGGGGGATGAAGGTTGAGGAG
GCGGAGGAGGTGGTAGATCTGCTGGGTGAGGCCAACATTCTCAGCCTGGAAGAGCAGCTGATTGACGCCACGACG
GACGAGGGCAAGAAGCAGCTCGAGGCGATGGAAGCCGAAGCTGCCGCCGCCGCCGCCGCTGCGACAAAGAGCGAC
GACGGAGCTTAA
Transcript >Ophcf2|06535
ATGCCCGTCGACTACAGTAAATGGGACGCGCTGGAGCTCAGCGACGACTCGGACATCGAAGTGCACCCCAACGTC
GACAAGCGATCCTTCATACGAGCCAAGCAGAATCAGATCCATCAAGACCGGCTCCAGCGGAAGCACCGGATCGAG
ACGCTCAAGTATGAGCGCATAATCAACGACGGCCTGCTGAAGCGCATCTCGTCCCTGCTCGCGGCGCTGAAAGGC
CATGCGTCCGAGGCAGCGACGCGGAACCCGGGCGAGATGGCCTTTCAGGCCGTCATGGAGTCGACCGGAGACGCC
AAAGAGGATCAGCCTCCGCCGCCGCCGGAGGGTGTGCACTCGGAGGTCGGGGAGCGGCCGACGTACTCCAAGATG
ATGGCGGTGCTGCTGGACCAGGTGAACAAGGCGCTGGACGAGAAGAAGGCGCAGGACCGATACGGCGCCATGATG
GACGAGATCCGGGGTCACGAGGAAAAGGTGGCCAAACTTCAGGGCGAACTGCTGGCCAAGCTGCGAGAGCTGGAG
AAGGAGGACGGCAAGAAGATTACCAGCGCCGACATTCATACGGGCTTTGACAGTTCCCACGTCAACAAATCAAAG
ACACCGGCCGAGAGCAGCAGCAGCGGCCAGTCGACGACTCAGGTTGAGCTCCTCAACCCGCAGGTGCAAAAGGGC
GACGACAAGAGCGGCGATGACCCGGAGGCCGAGGCGTCACCCGACGCCAAGAAGTTTGCGCAGATCAAGGCCAAC
GACTACACGACCAGCCTCCGCTTCCTGGCACAGCACCCACACATCCTGACGGAGCGCGACTCGGACGGCATCCTG
GTGCTGGCCTTTGACGCGGGGCTGGAAGGCGATGACGACGGGTGCCGACGATGTGTGCACCAGGGCCTGCTACTG
CAATACTGCCGCGCGCTCGGCAAGGACGGCGTCGGCCTCTTCTTCAAGCGCATCACGACAAAGGGCCACCAAGCG
CAGGATGTCTTCTACCGCGACGTGCAAGACACTTACACCCGGATCAGGAAGCGGTCTCGCGAGATTGTAGCCGAG
CGGGCGGCCGACCCCGAGGGCGAAGAGGTGGCGCAGATCCAGCTGCACGCCGTGGAACCGGGGACGGCCATCCAG
ATCCGCGTGCCGGACGCGGACGCCATGGAGCCTGAGGCGCGGAGGGCGCGAGACATCTTTGATGGCTTTCGGCCC
GAGTTGAGGGAGGCCTTGGCTTCGGGGGGGTTGGATGAGGTGAATCGGGTGCTGGGGGGGATGAAGGTTGAGGAG
GCGGAGGAGGTGGTAGATCTGCTGGGTGAGGCCAACATTCTCAGCCTGGAAGAGCAGCTGATTGACGCCACGACG
GACGAGGGCAAGAAGCAGCTCGAGGCGATGGAAGCCGAAGCTGCCGCCGCCGCCGCCGCTGCGACAAAGAGCGAC
GACGGAGCTTAA
Gene >Ophcf2|06535
ATGCCCGTCGACTACAGTAAATGGGTAAGTCAAAGATGCAGTCTAGTACAGGCCATCGCTCATACCCTCGACTGA
CGTTCCCCGCAGGACGCGCTGGAGCTCAGCGACGACTCGGACATCGAAGTGCACCCCAACGTCGACAAGCGATCC
TTCATACGAGCCAAGCAGAATCAGATCCATCAAGACCGGCTCCAGCGGAAGCACCGGATCGAGACGCTCAAGTAT
GAGCGCATAATCAACGACGGCCTGCTGAAGCGCATCTCGTCCCTGCTCGCGGCGCTGAAAGGCCATGCGTCCGAG
GCAGCGACGCGGAACCCGGGCGAGATGGCCTTTCAGGCCGTCATGGAGTCGACCGGAGACGCCAAAGAGGATCAG
CCTCCGCCGCCGCCGGAGGGTGTGCACTCGGAGGTCGGGGAGCGGCCGACGTACTCCAAGATGATGGCGGTGCTG
CTGGACCAGGTGAACAAGGCGCTGGACGAGAAGAAGGCGCAGGACCGATACGGCGCCATGATGGACGAGATCCGG
GGTCACGAGGAAAAGGTGGCCAAACTTCAGGGCGAACTGCTGGCCAAGCTGCGAGAGCTGGAGAAGGAGGACGGC
AAGAAGATTACCAGCGCCGACATTCATACGGGCTTTGACAGTTCCCACGTCAACAAATCAAAGACACCGGCCGAG
AGCAGCAGCAGCGGCCAGTCGACGACTCAGGTTGAGCTCCTCAACCCGCAGGTGCAAAAGGGCGACGACAAGAGC
GGCGATGACCCGGAGGCCGAGGCGTCACCCGACGCCAAGAAGTTTGCGCAGATCAAGGCCAACGACTACACGACC
AGCCTCCGCTTCCTGGCACAGCACCCACACATCCTGACGGAGCGCGACTCGGACGGCATCCTGGTGCTGGCCTTT
GACGCGGGGCTGGAAGGCGATGACGACGGGTGCCGACGATGTGTGCACCAGGGCCTGCTACTGCAATACTGCCGC
GCGCTCGGCAAGGACGGCGTCGGCCTCTTCTTCAAGCGCATCACGACAAAGGGCCACCAAGCGCAGGATGTCTTC
TACCGCGACGTGCAAGACACTTACACCCGGATCAGGAAGCGGTCTCGCGAGATTGTAGCCGAGCGGGCGGCCGAC
CCCGAGGGCGAAGAGGTGGCGCAGATCCAGCTGCACGCCGTGGAACCGGGGACGGCCATCCAGATCCGCGTGCCG
GACGCGGACGCCATGGAGCCTGAGGCGCGGAGGGCGCGAGACATCTTTGATGGCTTTCGGCCCGAGTTGAGGGAG
GCCTTGGCTTCGGGGGGGTTGGATGAGGTGAATCGGGTGCTGGGGGGGATGAAGGTTGAGGAGGCGGAGGAGGTG
GTAGATCTGCTGGGTGAGGTGAGTTTTCTCCCTGTCCTTCTCTCTATCTCCTTCTCTCTCTCTCCTCTCTCTCTT
ACACACAACACACACTCTCTCTCTCTCTCTCCAATCTCTCTCGTGTTTCGTGTCCCCCATCTTTCTCGGTCGTCA
CCTCTCTCAACCTTCCCTCTCACTCCCCTCGATGGAGAAGACGAGACTGACAGCGTCGACAGGCCAACATTCTCA
GCCTGGAAGAGCAGCTGATTGACGCCACGACGGACGAGGGCAAGAAGCAGCTCGAGGCGATGGAAGCCGAAGCTG
CCGCCGCCGCCGCCGCTGCGACAAAGAGCGACGACGGAGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail