Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06533
Gene name
Locationscaffold_08:365492..369286
Strand-
Gene length (bp)3794
Transcript length (bp)3600
Coding sequence length (bp)3600
Protein length (aa) 1200

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02463 SMC_N RecF/RecN/SMC N terminal domain 1.4E-60 2 1177
PF06470 SMC_hinge SMC proteins Flexible Hinge Domain 1.9E-25 522 634
PF13476 AAA_23 AAA domain 9.0E-18 5 206
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 1.4E-08 942 1156
PF13175 AAA_15 AAA ATPase domain 3.5E-09 1 356

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0005694 chromosome Yes
GO:0140664 ATP-dependent DNA damage sensor activity Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0051276 chromosome organization Yes
GO:0005515 protein binding Yes
GO:0017111 nucleoside-triphosphatase activity No
GO:0005575 cellular_component No
GO:0140097 catalytic activity, acting on DNA No
GO:0003824 catalytic activity No
GO:0006996 organelle organization No
GO:0140612 DNA damage sensor activity No
GO:0140299 small molecule sensor activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901265 nucleoside phosphate binding No
GO:0016787 hydrolase activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0071840 cellular component organization or biogenesis No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No
GO:0097159 organic cyclic compound binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0043228 non-membrane-bounded organelle No
GO:0030554 adenyl nucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0016043 cellular component organization No
GO:0140657 ATP-dependent activity No
GO:0016462 pyrophosphatase activity No
GO:0000166 nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0043229 intracellular organelle No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0016817 hydrolase activity, acting on acid anhydrides No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2413 0.8851 0.0126 0.1548 0.1688 0.0015 0.1251 0.0544 0.0281 0.0023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1881
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6994
Ophiocordyceps australis map64 (Brazil) OphauB2|5185
Ophiocordyceps camponoti-floridani Ophcf2|06533 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3196
Ophiocordyceps kimflemingae Ophio5|6891
Ophiocordyceps subramaniannii Hirsu2|1927

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06533
MYIKQIIIQGFKSYKEQTVIEPFSPKTNVIVGRNGSGKSNFFAAMRFVLSDAYTQMNREERQGLLHEGSGSAVLS
AYVEIIFDNSDDRFPTGGKEVILRRTIGLKKDEYSVDRKVVTKIDVMNLLEAAGFSRSNPYYIVPQGRVTALTNM
KESDRLNLLKEVAGTHVYETRRAESLKIMTETNNKREKIDELLEYIKERLAELEEEKEELRGFQEKDRERRCLEY
AYYHNEQTTIQSSLEDLDNARQDGLDTADSSRTELYEGEKAIAKLDAEMHQLQRDIEMLQIDHRQHEEDRRDYAK
ALAKAELKLKNLAEGQSAQEQAQAKHAAELESVQADIAAKEKELAKTLPQFAKKKRDEDDIRRQLDAAEASRARL
FGKQSRGSRFKNKAERDAWLRQEIKELDQTISAQKANKLEAEEEVGRVQLSISESEEELASLRSRLANRTGERNQ
LVEQASKARAMLDKLNDERKVIRREDDKLGSVIANARQEKEQAERELAHAVDGATARGLATLRRLRQEQKIPGAY
GTLADLLSVSDAYRLPAEQTAGASLFHYVVDNADTATYLADILHRQRGGRITFMPLAQLRPRHVNLPRANDAVPL
ISKITYDAKFDKAFRQVFGKTVVCPNLTVAGQYARSHGIDGITAEGDTTNKRGAMTGGWIDPRKSRLEAVQAANR
WREQYDKLLSQSREMRSQIERKDQEITAAMSEVQKLEQRLRQADDGFEPLKHELMSKSTHVENERSHLDAAMSRR
DAVEKNMAGFLEEIAAHEAEIGTEFKKSLTAAQEKQLEELSARVQQLQKQWNDVSDGRRKLEKSKQLLEVDLRQN
LQMKLDQLNSQAFENSASGASAGGMTEARRELMKAQKALQAVEASLEEVEGKMEELNERTEQVSSEKTQREQTQS
EITSRIERQQKRMEKTLARKALLTQQAAGCAKNIRELGMLPEEAFDKYENMEGKVITSKLKRVNEALKKYKHVNK
KAFEQYNNFTSQQDHLMKRRKELDASQESIEELVEHLDRRKDEAIERTFKQVSREFATIFGKLVPAGHGRLVIQR
RTDRRQDVDESDEEARGSVENYIGVGISVSFNSKHLDEQQKIQQLSGGQKSLCALCLIFALQATESSPMVIFDEV
DANLDAQYRTAVASLLESISNEVGTQFICTTFRPEIVHVADKCYGVTFRNKTSGISCVSTEDALNFVEGQAKPT*
Coding >Ophcf2|06533
ATGTATATCAAGCAGATCATTATCCAAGGCTTCAAAAGCTACAAAGAACAGACGGTCATCGAGCCCTTTTCGCCA
AAGACAAACGTCATCGTCGGTCGCAATGGCTCCGGCAAGAGCAACTTCTTCGCCGCCATGCGCTTCGTTCTCAGC
GATGCCTACACGCAGATGAATCGTGAGGAGCGACAGGGCCTCCTGCACGAGGGCTCTGGATCGGCAGTCTTGTCG
GCATACGTCGAGATCATCTTCGACAACAGCGACGACCGCTTCCCCACCGGCGGCAAAGAGGTCATCCTGAGGCGT
ACCATCGGTCTGAAGAAGGATGAATACTCCGTCGATCGCAAGGTTGTCACCAAGATCGACGTCATGAACCTGCTC
GAGGCGGCTGGCTTCTCGCGCTCCAACCCGTACTATATCGTGCCTCAGGGGCGCGTCACCGCCCTGACCAATATG
AAGGAGTCGGATAGGCTGAACCTGCTCAAGGAGGTTGCCGGCACCCACGTGTACGAGACCCGCCGGGCAGAGTCG
CTCAAGATCATGACCGAGACCAACAATAAGCGGGAAAAGATCGACGAGCTGCTCGAGTACATCAAGGAGAGGCTG
GCCGAGCTGGAGGAGGAGAAGGAAGAGCTCCGTGGATTTCAAGAAAAGGACCGAGAGCGGAGATGTCTTGAGTAC
GCCTACTATCACAACGAGCAAACCACGATCCAGTCCTCCCTCGAGGACCTGGACAACGCCAGACAGGATGGCCTC
GACACCGCGGACTCGAGCCGAACGGAGCTGTATGAGGGCGAAAAAGCCATTGCAAAACTTGATGCCGAGATGCAT
CAGCTGCAACGCGACATTGAGATGTTGCAGATAGACCATCGCCAGCACGAAGAAGATAGGCGAGACTACGCAAAG
GCCCTGGCCAAGGCCGAGCTCAAGCTCAAGAATCTGGCGGAAGGGCAATCGGCCCAGGAGCAAGCCCAAGCAAAG
CACGCCGCCGAGCTGGAATCGGTTCAGGCAGACATTGCGGCCAAGGAAAAGGAGCTGGCAAAGACACTGCCTCAG
TTTGCCAAGAAGAAACGGGACGAGGACGACATCCGGAGGCAGCTGGACGCGGCCGAGGCTTCGAGAGCTCGTCTG
TTCGGCAAGCAATCTCGCGGTTCTCGATTTAAGAACAAGGCCGAGAGAGATGCCTGGCTGAGACAGGAGATCAAG
GAGCTCGATCAGACCATCAGCGCGCAAAAGGCAAACAAGCTCGAAGCCGAGGAGGAGGTCGGCAGGGTGCAGCTC
TCCATCAGCGAGAGCGAAGAGGAACTCGCCAGCCTTCGATCCCGCCTCGCGAATCGGACCGGCGAGAGGAACCAG
CTCGTCGAGCAGGCCTCCAAGGCAAGGGCCATGCTCGACAAGCTCAACGACGAGCGCAAAGTAATCCGCCGTGAG
GATGACAAGCTCGGCTCCGTCATCGCCAACGCCAGGCAGGAGAAGGAGCAGGCGGAGCGCGAGCTGGCCCACGCC
GTCGACGGCGCAACAGCTCGAGGCCTCGCCACTCTCCGCCGATTGCGGCAAGAGCAGAAGATTCCAGGCGCCTAC
GGCACGCTGGCTGATCTGCTGAGCGTCAGCGACGCCTATCGGTTGCCCGCCGAACAGACGGCGGGCGCGAGCCTG
TTCCACTACGTTGTCGACAACGCCGACACGGCGACGTATCTGGCCGATATCCTCCACCGGCAGCGCGGCGGGCGC
ATCACCTTTATGCCGCTCGCCCAATTGCGTCCGCGTCACGTCAACCTGCCGAGAGCCAACGACGCGGTACCGCTG
ATCAGCAAGATCACGTACGACGCCAAGTTCGACAAGGCATTCCGACAGGTGTTTGGGAAGACGGTCGTGTGTCCG
AACCTGACGGTGGCTGGTCAGTACGCTCGAAGCCACGGCATCGACGGCATCACGGCCGAAGGCGATACCACCAAC
AAGAGGGGCGCCATGACGGGCGGATGGATCGATCCTCGCAAGTCGCGGTTAGAGGCCGTACAGGCGGCCAACCGT
TGGCGGGAGCAATACGATAAGCTGCTTTCCCAGTCGCGGGAGATGCGAAGCCAGATCGAACGTAAAGACCAGGAG
ATCACGGCGGCCATGTCCGAGGTGCAGAAGCTCGAACAGAGGCTACGGCAGGCCGACGACGGGTTCGAGCCGCTC
AAGCACGAGCTGATGAGCAAGTCGACGCACGTGGAAAACGAGAGAAGCCACTTGGACGCGGCCATGAGTCGACGC
GACGCCGTGGAGAAGAACATGGCCGGCTTCCTGGAGGAGATTGCCGCGCACGAGGCCGAGATCGGGACCGAGTTC
AAGAAGAGCCTCACGGCGGCCCAAGAGAAGCAGCTGGAAGAGCTGAGCGCGAGGGTGCAGCAACTCCAGAAGCAG
TGGAACGACGTGAGCGACGGTCGCAGGAAGCTGGAGAAGTCGAAGCAGCTCCTCGAGGTCGATCTGCGGCAGAAC
CTCCAGATGAAGCTCGACCAGCTCAACAGCCAGGCCTTTGAGAACTCGGCATCAGGAGCGTCGGCCGGAGGCATG
ACGGAGGCCCGGAGAGAGCTGATGAAGGCGCAGAAGGCGCTGCAAGCCGTCGAGGCCAGCCTCGAGGAGGTCGAG
GGCAAGATGGAAGAGCTCAACGAGCGGACGGAGCAAGTGTCTAGCGAAAAGACGCAGCGAGAGCAGACGCAGAGC
GAAATCACGTCGAGGATAGAGAGGCAGCAGAAGAGGATGGAAAAGACGCTGGCCCGCAAAGCTCTCCTGACGCAG
CAAGCAGCCGGGTGCGCCAAGAACATCCGGGAGCTCGGCATGCTCCCGGAGGAGGCCTTTGACAAGTACGAGAAC
ATGGAGGGCAAAGTGATCACGTCGAAGCTCAAGCGGGTGAACGAGGCGCTCAAGAAGTACAAGCACGTCAACAAG
AAGGCTTTCGAGCAGTATAACAACTTCACGTCGCAGCAGGACCATCTGATGAAGCGGCGCAAGGAGCTTGACGCG
TCACAGGAGTCCATCGAGGAGCTGGTCGAGCATCTAGACCGACGAAAGGACGAGGCCATCGAGCGCACTTTCAAG
CAGGTATCTCGCGAGTTCGCCACCATCTTCGGCAAGCTGGTGCCGGCCGGCCACGGCCGTCTGGTGATCCAGCGG
CGGACCGACCGTCGTCAGGACGTGGACGAGTCGGACGAGGAGGCGAGGGGCAGCGTCGAGAACTACATCGGCGTC
GGCATCAGCGTCTCCTTCAACTCGAAGCATCTGGACGAGCAGCAGAAGATCCAACAGCTCAGCGGAGGCCAGAAG
AGCCTGTGCGCTCTCTGCCTCATCTTCGCCCTGCAGGCTACGGAGAGCAGCCCGATGGTCATCTTCGACGAGGTA
GACGCCAATCTAGACGCCCAGTACCGCACCGCCGTCGCCTCCCTACTGGAATCCATCTCCAACGAGGTCGGCACG
CAGTTCATCTGCACCACGTTCCGACCCGAGATCGTCCACGTGGCAGACAAGTGTTATGGCGTCACGTTCCGCAAC
AAGACGAGCGGCATCAGCTGCGTCAGTACCGAAGACGCTCTCAACTTTGTCGAGGGGCAGGCCAAGCCGACGTGA
Transcript >Ophcf2|06533
ATGTATATCAAGCAGATCATTATCCAAGGCTTCAAAAGCTACAAAGAACAGACGGTCATCGAGCCCTTTTCGCCA
AAGACAAACGTCATCGTCGGTCGCAATGGCTCCGGCAAGAGCAACTTCTTCGCCGCCATGCGCTTCGTTCTCAGC
GATGCCTACACGCAGATGAATCGTGAGGAGCGACAGGGCCTCCTGCACGAGGGCTCTGGATCGGCAGTCTTGTCG
GCATACGTCGAGATCATCTTCGACAACAGCGACGACCGCTTCCCCACCGGCGGCAAAGAGGTCATCCTGAGGCGT
ACCATCGGTCTGAAGAAGGATGAATACTCCGTCGATCGCAAGGTTGTCACCAAGATCGACGTCATGAACCTGCTC
GAGGCGGCTGGCTTCTCGCGCTCCAACCCGTACTATATCGTGCCTCAGGGGCGCGTCACCGCCCTGACCAATATG
AAGGAGTCGGATAGGCTGAACCTGCTCAAGGAGGTTGCCGGCACCCACGTGTACGAGACCCGCCGGGCAGAGTCG
CTCAAGATCATGACCGAGACCAACAATAAGCGGGAAAAGATCGACGAGCTGCTCGAGTACATCAAGGAGAGGCTG
GCCGAGCTGGAGGAGGAGAAGGAAGAGCTCCGTGGATTTCAAGAAAAGGACCGAGAGCGGAGATGTCTTGAGTAC
GCCTACTATCACAACGAGCAAACCACGATCCAGTCCTCCCTCGAGGACCTGGACAACGCCAGACAGGATGGCCTC
GACACCGCGGACTCGAGCCGAACGGAGCTGTATGAGGGCGAAAAAGCCATTGCAAAACTTGATGCCGAGATGCAT
CAGCTGCAACGCGACATTGAGATGTTGCAGATAGACCATCGCCAGCACGAAGAAGATAGGCGAGACTACGCAAAG
GCCCTGGCCAAGGCCGAGCTCAAGCTCAAGAATCTGGCGGAAGGGCAATCGGCCCAGGAGCAAGCCCAAGCAAAG
CACGCCGCCGAGCTGGAATCGGTTCAGGCAGACATTGCGGCCAAGGAAAAGGAGCTGGCAAAGACACTGCCTCAG
TTTGCCAAGAAGAAACGGGACGAGGACGACATCCGGAGGCAGCTGGACGCGGCCGAGGCTTCGAGAGCTCGTCTG
TTCGGCAAGCAATCTCGCGGTTCTCGATTTAAGAACAAGGCCGAGAGAGATGCCTGGCTGAGACAGGAGATCAAG
GAGCTCGATCAGACCATCAGCGCGCAAAAGGCAAACAAGCTCGAAGCCGAGGAGGAGGTCGGCAGGGTGCAGCTC
TCCATCAGCGAGAGCGAAGAGGAACTCGCCAGCCTTCGATCCCGCCTCGCGAATCGGACCGGCGAGAGGAACCAG
CTCGTCGAGCAGGCCTCCAAGGCAAGGGCCATGCTCGACAAGCTCAACGACGAGCGCAAAGTAATCCGCCGTGAG
GATGACAAGCTCGGCTCCGTCATCGCCAACGCCAGGCAGGAGAAGGAGCAGGCGGAGCGCGAGCTGGCCCACGCC
GTCGACGGCGCAACAGCTCGAGGCCTCGCCACTCTCCGCCGATTGCGGCAAGAGCAGAAGATTCCAGGCGCCTAC
GGCACGCTGGCTGATCTGCTGAGCGTCAGCGACGCCTATCGGTTGCCCGCCGAACAGACGGCGGGCGCGAGCCTG
TTCCACTACGTTGTCGACAACGCCGACACGGCGACGTATCTGGCCGATATCCTCCACCGGCAGCGCGGCGGGCGC
ATCACCTTTATGCCGCTCGCCCAATTGCGTCCGCGTCACGTCAACCTGCCGAGAGCCAACGACGCGGTACCGCTG
ATCAGCAAGATCACGTACGACGCCAAGTTCGACAAGGCATTCCGACAGGTGTTTGGGAAGACGGTCGTGTGTCCG
AACCTGACGGTGGCTGGTCAGTACGCTCGAAGCCACGGCATCGACGGCATCACGGCCGAAGGCGATACCACCAAC
AAGAGGGGCGCCATGACGGGCGGATGGATCGATCCTCGCAAGTCGCGGTTAGAGGCCGTACAGGCGGCCAACCGT
TGGCGGGAGCAATACGATAAGCTGCTTTCCCAGTCGCGGGAGATGCGAAGCCAGATCGAACGTAAAGACCAGGAG
ATCACGGCGGCCATGTCCGAGGTGCAGAAGCTCGAACAGAGGCTACGGCAGGCCGACGACGGGTTCGAGCCGCTC
AAGCACGAGCTGATGAGCAAGTCGACGCACGTGGAAAACGAGAGAAGCCACTTGGACGCGGCCATGAGTCGACGC
GACGCCGTGGAGAAGAACATGGCCGGCTTCCTGGAGGAGATTGCCGCGCACGAGGCCGAGATCGGGACCGAGTTC
AAGAAGAGCCTCACGGCGGCCCAAGAGAAGCAGCTGGAAGAGCTGAGCGCGAGGGTGCAGCAACTCCAGAAGCAG
TGGAACGACGTGAGCGACGGTCGCAGGAAGCTGGAGAAGTCGAAGCAGCTCCTCGAGGTCGATCTGCGGCAGAAC
CTCCAGATGAAGCTCGACCAGCTCAACAGCCAGGCCTTTGAGAACTCGGCATCAGGAGCGTCGGCCGGAGGCATG
ACGGAGGCCCGGAGAGAGCTGATGAAGGCGCAGAAGGCGCTGCAAGCCGTCGAGGCCAGCCTCGAGGAGGTCGAG
GGCAAGATGGAAGAGCTCAACGAGCGGACGGAGCAAGTGTCTAGCGAAAAGACGCAGCGAGAGCAGACGCAGAGC
GAAATCACGTCGAGGATAGAGAGGCAGCAGAAGAGGATGGAAAAGACGCTGGCCCGCAAAGCTCTCCTGACGCAG
CAAGCAGCCGGGTGCGCCAAGAACATCCGGGAGCTCGGCATGCTCCCGGAGGAGGCCTTTGACAAGTACGAGAAC
ATGGAGGGCAAAGTGATCACGTCGAAGCTCAAGCGGGTGAACGAGGCGCTCAAGAAGTACAAGCACGTCAACAAG
AAGGCTTTCGAGCAGTATAACAACTTCACGTCGCAGCAGGACCATCTGATGAAGCGGCGCAAGGAGCTTGACGCG
TCACAGGAGTCCATCGAGGAGCTGGTCGAGCATCTAGACCGACGAAAGGACGAGGCCATCGAGCGCACTTTCAAG
CAGGTATCTCGCGAGTTCGCCACCATCTTCGGCAAGCTGGTGCCGGCCGGCCACGGCCGTCTGGTGATCCAGCGG
CGGACCGACCGTCGTCAGGACGTGGACGAGTCGGACGAGGAGGCGAGGGGCAGCGTCGAGAACTACATCGGCGTC
GGCATCAGCGTCTCCTTCAACTCGAAGCATCTGGACGAGCAGCAGAAGATCCAACAGCTCAGCGGAGGCCAGAAG
AGCCTGTGCGCTCTCTGCCTCATCTTCGCCCTGCAGGCTACGGAGAGCAGCCCGATGGTCATCTTCGACGAGGTA
GACGCCAATCTAGACGCCCAGTACCGCACCGCCGTCGCCTCCCTACTGGAATCCATCTCCAACGAGGTCGGCACG
CAGTTCATCTGCACCACGTTCCGACCCGAGATCGTCCACGTGGCAGACAAGTGTTATGGCGTCACGTTCCGCAAC
AAGACGAGCGGCATCAGCTGCGTCAGTACCGAAGACGCTCTCAACTTTGTCGAGGGGCAGGCCAAGCCGACGTGA
Gene >Ophcf2|06533
ATGTATATCAAGCAGATCATTATCCAAGGCTTCAAAAGGTGAGTCCGCTCTCATCTTCTGCTGCAGGCGCTGCTG
ACTGTCAATCTCAGCTACAAAGAACAGACGGTCATCGAGCCCTTTTCGCCAAAGACAAACGTCATCGTCGGTCGC
AATGGCTCCGGCAAGAGCAACTTCTTCGCCGCCATGCGCTTCGTTCTCAGCGATGCCTACACGCAGATGAATCGT
GAGGAGCGACAGGGCCTCCTGCACGAGGGCTCTGGATCGGCAGTCTTGTCGGCATACGTCGAGATCATCTTCGAC
AACAGCGACGACCGCTTCCCCACCGGCGGCAAAGAGGTCATCCTGAGGCGTACCATCGGTCTGAAGAAGGATGAA
TACTCCGTCGATCGCAAGGTTGTCACCAAGATCGACGTCATGAACCTGCTCGAGGCGGCTGGCTTCTCGCGCTCC
AACCCGTACTATATCGTGCCTCAGGGGCGCGTCACCGCCCTGACCAATATGAAGGAGTCGGATAGGCTGAACCTG
CTCAAGGAGGTTGCCGGCACCCACGTGTACGAGACCCGCCGGGCAGAGTCGCTCAAGATCATGACCGAGACCAAC
AATAAGCGGGAAAAGATCGACGAGCTGCTCGAGTACATCAAGGAGAGGCTGGCCGAGCTGGAGGAGGAGAAGGAA
GAGCTCCGTGGATTTCAAGAAAAGGACCGAGAGCGGAGATGTCTTGAGTACGCCTACTATCACAACGAGCAAACC
ACGATCCAGTCCTCCCTCGAGGACCTGGACAACGCCAGACAGGATGGCCTCGACACCGCGGACTCGAGCCGAACG
GAGCTGTATGAGGGCGAAAAAGCCATTGCAAAACTTGATGCCGAGATGCATCAGCTGCAACGCGACATTGAGATG
TTGCAGATAGACCATCGCCAGCACGAAGAAGATAGGCGAGACTACGCAAAGGCCCTGGCCAAGGCCGAGCTCAAG
CTCAAGAATCTGGCGGAAGGGCAATCGGCCCAGGAGCAAGCCCAAGCAAAGCACGCCGCCGAGCTGGAATCGGTT
CAGGCAGACATTGCGGCCAAGGAAAAGGAGCTGGCAAAGACACTGCCTCAGTTTGCCAAGAAGAAACGGGACGAG
GACGACATCCGGAGGCAGCTGGACGCGGCCGAGGCTTCGAGAGCTCGTCTGTTCGGCAAGCAATCTCGCGGTTCT
CGATTTAAGAACAAGGCCGAGAGAGATGCCTGGCTGAGACAGGAGATCAAGGAGCTCGATCAGACCATCAGCGCG
CAAAAGGCAAACAAGCTCGAAGCCGAGGAGGAGGTCGGCAGGGTGCAGCTCTCCATCAGCGAGAGCGAAGAGGAA
CTCGCCAGCCTTCGATCCCGCCTCGCGAATCGGACCGGCGAGAGGAACCAGCTCGTCGAGCAGGCCTCCAAGGCA
AGGGCCATGCTCGACAAGCTCAACGACGAGCGCAAAGTAATCCGCCGTGAGGATGACAAGCTCGGCTCCGTCATC
GCCAACGCCAGGCAGGAGAAGGAGCAGGCGGAGCGCGAGCTGGCCCACGCCGTCGACGGCGCAACAGCTCGAGGC
CTCGCCACTCTCCGCCGATTGCGGCAAGAGCAGAAGATTCCAGGCGCCTACGGCACGCTGGCTGATCTGCTGAGC
GTCAGCGACGCCTATCGGTTGCCCGCCGAACAGACGGCGGGCGCGAGCCTGTTCCACTACGTTGTCGACAACGCC
GACACGGCGACGTATCTGGCCGATATCCTCCACCGGCAGCGCGGCGGGCGCATCACCTTTATGCCGCTCGCCCAA
TTGCGTCCGCGTCACGTCAACCTGCCGAGAGCCAACGACGCGGTACCGCTGATCAGCAAGATCACGTACGACGCC
AAGTTCGACAAGGCATTCCGACAGGTGTTTGGGAAGACGGTCGTGTGTCCGAACCTGACGGTGGCTGGTCAGTAC
GCTCGAAGCCACGGCATCGACGGCATCACGGCCGAAGGCGATACCACCAACAAGAGGGGCGCCATGACGGGCGGA
TGGATCGATCCTCGCAAGTCGCGGTTAGAGGCCGTACAGGCGGCCAACCGTTGGCGGGAGCAATACGATAAGCTG
CTTTCCCAGTCGCGGGAGATGCGAAGCCAGATCGAACGTAAAGACCAGGAGATCACGGCGGCCATGTCCGAGGTG
CAGAAGCTCGAACAGAGGCTACGGCAGGCCGACGACGGGTTCGAGCCGCTCAAGCACGAGCTGATGAGCAAGTCG
ACGCACGTGGAAAACGAGAGAAGCCACTTGGACGCGGCCATGAGTCGACGCGACGCCGTGGAGAAGAACATGGCC
GGCTTCCTGGAGGAGATTGCCGCGCACGAGGCCGAGATCGGGACCGAGTTCAAGAAGAGCCTCACGGCGGCCCAA
GAGAAGCAGCTGGAAGAGCTGAGCGCGAGGGTGCAGCAACTCCAGAAGCAGTGGAACGACGTGAGCGACGGTCGC
AGGAAGCTGGAGAAGTCGAAGCAGCTCCTCGAGGTCGATCTGCGGCAGAACCTCCAGATGAAGCTCGACCAGCTC
AACAGCCAGGCCTTTGAGAACTCGGCATCAGGAGCGTCGGCCGGAGGCATGACGGAGGCCCGGAGAGAGCTGATG
AAGGCGCAGAAGGCGCTGCAAGCCGTCGAGGCCAGCCTCGAGGAGGTCGAGGGCAAGATGGAAGAGCTCAACGAG
CGGACGGAGCAAGTGTCTAGCGAAAAGACGCAGCGAGAGCAGACGCAGAGCGAAATCACGTCGAGGATAGAGAGG
CAGCAGAAGAGGATGGAAAAGACGCTGGCCCGCAAAGCTCTCCTGACGCAGCAAGCAGCCGGGTGCGCCAAGAAC
ATCCGGGAGCTCGGCATGCTCCCGGAGGAGGCCTTTGACAAGTACGAGAACATGGAGGGCAAAGTGGTGCGTTGA
CCCGCCTATGCTCGGTAAGATGTACGTGTTGCTGATGAGACGGCACAGATCACGTCGAAGCTCAAGCGGGTGAAC
GAGGCGCTCAAGAAGTACAAGCACGTCAACAAGAAGGCTTTCGAGCAGTATAACAACTTCACGTCGCAGCAGGAC
CATCTGATGAAGCGGCGCAAGGAGCTTGACGCGTCACAGGAGTCCATCGAGGAGCTGGTCGAGCATCTAGACCGA
CGAAAGGACGAGGCCATCGAGCGCACTTTCAAGCAGGTATCTCGCGAGTTCGCCACCATCTTCGGCAAGCTGGTG
CCGGCCGGCCACGGCCGTCTGGTGATCCAGCGGCGGACCGACCGTCGTCAGGACGTGGACGAGTCGGACGAGGAG
GCGAGGGGCAGCGTCGAGAACTACATCGGCGTCGGCATCAGCGTCTCCTTCAACTCGAAGCATCTGGACGAGCAG
CAGAAGATCCAACAGCTCAGCGGAGGCCAGAAGAGTAAGGAACCCACCCCCTTTTTGATGTTTGGAGTCGACGAC
GACGACGACGACGACGACGAAGACGACGCTGACCTCGTCCATCAGGCCTGTGCGCTCTCTGCCTCATCTTCGCCC
TGCAGGCTACGGAGAGCAGCCCGATGGTCATCTTCGACGAGGTAGACGCCAATCTAGACGCCCAGTACCGCACCG
CCGTCGCCTCCCTACTGGAATCCATCTCCAACGAGGTCGGCACGCAGTTCATCTGCACCACGTTCCGACCCGAGA
TCGTCCACGTGGCAGACAAGTGTTATGGCGTCACGTTCCGCAACAAGACGAGCGGCATCAGCTGCGTCAGTACCG
AAGACGCTCTCAACTTTGTCGAGGGGCAGGCCAAGCCGACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail