Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06529
Gene name
Locationscaffold_08:355866..357365
Strand-
Gene length (bp)1499
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03435 Sacchrp_dh_NADP Saccharopine dehydrogenase NADP binding domain 2.6E-16 5 135

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 288 307 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 282.75 143.36 422.13
Alive In ants, during behavior modification 173.05 87.25 258.84
Dead In ants, recently dead 133.56 75.14 191.99

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.020835 yes
Alive Dead 0.137310 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06529
MYDLVILGATGYTGLLTAEHVATNLPSSLKWALAGRSKAKLQTVADECKQLSPTMSTPELELVNVDDADQMDALV
RKTSLVITTVGPYFRFGEAVVRACAQAGTHYVDCTGETPWVASMIKKYEGAARQSGAILVPCNGVESAATDLITW
SLVSFVKEKLGVGVEDVVLSIHKSSIVPSGGTVATAMGVFDHYSLSDLMSNRKPYALSPVPHPERQRPVSSFLNT
LLGIRHVPDLGLQATSLQAAVDAPVIERTWGLLQQTPSRKAQFYGPKFNWIAYQKPRNWLSGIAMHWVLAVGTVI
IALVAPVRTLIKKLAHEPGQGLSKDGMAREELDYRGTAVPDDPSGAVKKRAYCRAQYRGSSYQATALFLAHAAQT
MLEDKMELPGGFYTPACLGKGYVDRVNRAGFKIDVKMLDD*
Coding >Ophcf2|06529
ATGTACGATCTCGTCATCTTGGGAGCTACCGGCTATACTGGCCTCTTGACGGCCGAGCACGTCGCTACCAATCTC
CCTTCCAGTCTCAAATGGGCTCTCGCAGGCCGCTCCAAGGCCAAGCTGCAGACCGTGGCGGACGAATGCAAGCAG
TTGAGCCCTACCATGTCGACGCCTGAGCTGGAGCTGGTTAATGTGGATGACGCGGATCAGATGGACGCCCTCGTT
CGCAAGACGTCGCTCGTCATCACCACGGTTGGCCCTTACTTTCGCTTCGGCGAGGCTGTGGTTCGGGCTTGTGCT
CAGGCTGGCACTCACTATGTTGACTGCACCGGCGAGACCCCCTGGGTGGCGAGCATGATTAAGAAATACGAGGGA
GCGGCGAGGCAGAGCGGTGCCATCTTGGTTCCCTGCAATGGCGTCGAGTCGGCTGCCACCGACCTCATCACCTGG
AGCCTCGTGAGCTTCGTCAAGGAGAAGCTAGGCGTTGGAGTAGAGGACGTCGTTCTATCCATCCACAAGTCCAGC
ATCGTCCCGTCCGGCGGCACCGTCGCCACGGCAATGGGCGTCTTCGACCACTACTCCCTCTCGGATCTCATGTCC
AACAGAAAGCCCTACGCCCTCTCCCCCGTCCCGCACCCTGAAAGGCAGCGCCCCGTCTCGTCGTTCCTCAACACC
CTCCTCGGCATCCGACACGTACCCGATCTCGGCCTCCAGGCGACGTCGCTACAGGCGGCCGTCGACGCGCCGGTG
ATAGAGCGCACATGGGGCCTCCTTCAGCAGACCCCCTCGCGCAAGGCCCAGTTCTACGGCCCCAAATTCAACTGG
ATCGCCTACCAGAAGCCGCGGAACTGGCTCTCCGGCATAGCCATGCACTGGGTCCTCGCCGTCGGCACCGTCATC
ATCGCCCTCGTCGCCCCCGTCAGGACCCTCATCAAGAAGCTCGCCCACGAGCCTGGCCAGGGCCTCAGCAAGGAC
GGCATGGCCAGAGAGGAGCTCGACTACCGCGGAACGGCCGTGCCGGATGATCCGTCGGGAGCCGTCAAGAAGCGA
GCCTACTGTCGGGCTCAGTACCGCGGCAGCTCGTATCAAGCCACGGCTCTCTTCTTGGCGCACGCGGCTCAGACG
ATGCTCGAGGATAAGATGGAGCTTCCAGGAGGCTTCTACACGCCGGCCTGCCTCGGCAAGGGCTACGTCGATCGC
GTGAACCGCGCTGGCTTCAAGATCGATGTCAAGATGTTGGATGATTAG
Transcript >Ophcf2|06529
ATGTACGATCTCGTCATCTTGGGAGCTACCGGCTATACTGGCCTCTTGACGGCCGAGCACGTCGCTACCAATCTC
CCTTCCAGTCTCAAATGGGCTCTCGCAGGCCGCTCCAAGGCCAAGCTGCAGACCGTGGCGGACGAATGCAAGCAG
TTGAGCCCTACCATGTCGACGCCTGAGCTGGAGCTGGTTAATGTGGATGACGCGGATCAGATGGACGCCCTCGTT
CGCAAGACGTCGCTCGTCATCACCACGGTTGGCCCTTACTTTCGCTTCGGCGAGGCTGTGGTTCGGGCTTGTGCT
CAGGCTGGCACTCACTATGTTGACTGCACCGGCGAGACCCCCTGGGTGGCGAGCATGATTAAGAAATACGAGGGA
GCGGCGAGGCAGAGCGGTGCCATCTTGGTTCCCTGCAATGGCGTCGAGTCGGCTGCCACCGACCTCATCACCTGG
AGCCTCGTGAGCTTCGTCAAGGAGAAGCTAGGCGTTGGAGTAGAGGACGTCGTTCTATCCATCCACAAGTCCAGC
ATCGTCCCGTCCGGCGGCACCGTCGCCACGGCAATGGGCGTCTTCGACCACTACTCCCTCTCGGATCTCATGTCC
AACAGAAAGCCCTACGCCCTCTCCCCCGTCCCGCACCCTGAAAGGCAGCGCCCCGTCTCGTCGTTCCTCAACACC
CTCCTCGGCATCCGACACGTACCCGATCTCGGCCTCCAGGCGACGTCGCTACAGGCGGCCGTCGACGCGCCGGTG
ATAGAGCGCACATGGGGCCTCCTTCAGCAGACCCCCTCGCGCAAGGCCCAGTTCTACGGCCCCAAATTCAACTGG
ATCGCCTACCAGAAGCCGCGGAACTGGCTCTCCGGCATAGCCATGCACTGGGTCCTCGCCGTCGGCACCGTCATC
ATCGCCCTCGTCGCCCCCGTCAGGACCCTCATCAAGAAGCTCGCCCACGAGCCTGGCCAGGGCCTCAGCAAGGAC
GGCATGGCCAGAGAGGAGCTCGACTACCGCGGAACGGCCGTGCCGGATGATCCGTCGGGAGCCGTCAAGAAGCGA
GCCTACTGTCGGGCTCAGTACCGCGGCAGCTCGTATCAAGCCACGGCTCTCTTCTTGGCGCACGCGGCTCAGACG
ATGCTCGAGGATAAGATGGAGCTTCCAGGAGGCTTCTACACGCCGGCCTGCCTCGGCAAGGGCTACGTCGATCGC
GTGAACCGCGCTGGCTTCAAGATCGATGTCAAGATGTTGGATGATTAG
Gene >Ophcf2|06529
ATGTACGATCTCGTCATCTTGGGAGCTACCGGTGAGGAAACCGCGCGGTCGACACGAGTCTTCTCTTTACCGCTG
GTGCTGATTCCATGACGCAGGCTATACTGGCCTCTTGACGGCCGAGCACGTCGCTACCAATCTCCCTTCCAGTCT
CAAATGGGCTCTCGCAGGCCGCTCCAAGGCCAAGCTGCAGACCGTGGCGGACGAATGCAAGCAGTTGAGCCCTAC
CATGTCGACGCCTGGTGTGTTCTCCCCTTCGCAACCTTGCTTATTTCGATCCGAGCGCTGAGCGTGTGAATGGTC
AAAGAGCTGGAGCTGGTTAATGTGGATGACGCGGATCAGATGGACGCCCTCGTTCGCAAGACGTCGCTCGTCATC
ACCACGGTTGGCCCTTACTTTCGCTTCGGCGAGGCTGTGGTTCGGGCTTGTGCTCAGGCTGGCACTCACTATGTT
GACTGCACCGGCGAGACCCCCTGGGTGGCGAGCATGATTAAGAAATACGAGGGAGCGGCGAGGCAGAGCGGTGCC
ATCTTGGTTCCCTGCAATGGCGTCGAGTCGGCTGCCACCGACCTCATCACCTGGAGCCTCGTGAGCTTCGTCAAG
GAGAAGCTAGGCGTTGGAGTAGAGGACGTCGTTCTATCCATCCACAAGTCCAGGTCAGTCATCGTCTCCCCCATC
CAGTCGACGCCAATATCACAACATCTCCTCTAACACCAGCATGGCAGCATCGTCCCGTCCGGCGGCACCGTCGCC
ACGGCAATGGGCGTCTTCGACCACTACTCCCTCTCGGATCTCATGTCCAACAGAAAGCCCTACGCCCTCTCCCCC
GTCCCGCACCCTGAAAGGCAGCGCCCCGTCTCGTCGTTCCTCAACACCCTCCTCGGCATCCGACACGTACCCGAT
CTCGGCCTCCAGGCGACGTCGCTACAGGCGGCCGTCGACGCGCCGGTGATAGAGCGCACATGGGGCCTCCTTCAG
CAGACCCCCTCGCGCAAGGCCCAGTTCTACGGCCCCAAATTCAACTGGATCGCCTACCAGAAGCCGCGGAACTGG
CTCTCCGGCATAGCCATGCACTGGGTCCTCGCCGTCGGCACCGTCATCATCGCCCTCGTCGCCCCCGTCAGGACC
CTCATCAAGAAGCTCGCCCACGAGCCTGGCCAGGGCCTCAGCAAGGACGGCATGGCCAGAGAGGAGCTCGACTAC
CGCGGAACGGCCGTGCCGGATGATCCGTCGGGAGCCGTCAAGAAGCGAGCCTACTGTCGGGCTCAGTACCGCGGC
AGCTCGTATCAAGGTGAGTCTCGCGACCCTATTATATCCCCTACGGGAAAGCTAACGATGGGAAAGCCACGGCTC
TCTTCTTGGCGCACGCGGCTCAGACGATGCTCGAGGATAAGATGGAGCTTCCAGGAGGCTTCTACACGCCGGCCT
GCCTCGGCAAGGGCTACGTCGATCGCGTGAACCGCGCTGGCTTCAAGATCGATGTCAAGATGTTGGATGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail