Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06524
Gene name
Locationscaffold_08:344037..347719
Strand+
Gene length (bp)3682
Transcript length (bp)3414
Coding sequence length (bp)3414
Protein length (aa) 1138

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15411 PH_10 Pleckstrin homology domain 2.7E-26 397 508
PF00092 VWA von Willebrand factor type A domain 5.0E-14 584 749
PF13768 VWA_3 von Willebrand factor type A domain 2.7E-12 584 737

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.628 0.3357 0.122 0.1884 0.1181 0.0156 0.1476 0.4114 0.2426 0.0361

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4527
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6984
Ophiocordyceps australis map64 (Brazil) OphauB2|5175
Ophiocordyceps camponoti-floridani Ophcf2|06524 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6830
Ophiocordyceps kimflemingae Ophio5|4387
Ophiocordyceps subramaniannii Hirsu2|9461

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06524
MFSRVRRSQRHRSGHAGPDPNKGPNLSTDLSLIVGNPQGPPRPMPLANQSVYLEKGSLYSEDFASLRRDSFASSA
SSSFVFGTGLRRVAAVDNNVMASTVERSRHRRERTFVGSECAVCEEPLEHTLQGERILQFSCSHVSHEACFYEFI
REVDSQHCPTCDAPLHLDTSRGGNVIDINKMSTMMRSDSRSAHTPTPSWDNQTVRSPSIGSSHKNLPALPALPVL
PYGPAQKDLPRGHSSREPSDRYGPSRHDSEVASSGYPETAQSAPARRHDYDLQAMETSPGSPRPISRNPIPPPTI
TVRSEFPTLTRSRQQQTLTCLITVEAASNKWRPDLEDLGVQPLQVPSLEARVDDAMTRQPVAMPAPLYPYESADV
LEEMAENLRHRVDSWHGLIVDDFGPLRLYGTLRVGKNKVSWQVLECYLFAKMLICVKEKKQAPQWDDNGIPQRTA
TVCTLKGSILIKKHLNDVVETGTIDENVLTLTLSAGELPQFHLKFDNRNQLKLWNQALVDLITVDEPSSFRISDY
DHEISETEDDVDWNRSRSKRVSSTASSWGPKSATTAPTEYTSFTARSPRLGSPMHVPIDVVVVVPISSSMQGVKI
NLVRDALKFMIGNLGERDRLGIVTFGSASGGTPMSGMMTKSYADWPKVLASIKPVGQKSPRADVVEGANVAMDQL
MERKHSNPIATIMLISDASTADPDSVDFVVSRAEAAKITIHSFGLGTSHKPDTMIELSTRTKASYTYVKDWMMLR
ECLAGCLGGLQTLSHQNVKLKLKLPEGSPAKFHKISGALQITKRATGRDAEASLGDLRFGDKRDVLVQLVITPDS
MSQDQLPQDPWDNIVSGLEALGGSVEAEADRIASVEEVPLVQADLSWGDILRDGTVTQMPRPSLLTVTGLPAPTG
QKKAWATNAPPPIPPHPSIVQRRMELLTSDMLTRALTLVSRGQHDRAHTLLNETRSILKGLGKGGLPPVPPPRLP
TPLPNSTKSAPTTPHHVGGDATPHVAGTPDRKRSPSPPTSTASSTSSGNSGNGFSAGRLARSRSTDHLGGVGRGI
DPGTVAALDAELESSLEWINHPAVFARDSRKAVLQAIGVISSQRAFTFRSPIESLWAGRVGGIKRLADKSREWRE
EGGGEGGIMEEA*
Coding >Ophcf2|06524
ATGTTCAGTCGCGTTCGACGAAGCCAGCGGCACCGCAGCGGCCACGCGGGTCCCGATCCCAACAAGGGCCCGAAT
TTGTCGACGGACCTGAGCCTAATCGTCGGCAATCCCCAGGGTCCTCCCCGTCCCATGCCACTAGCCAACCAGTCC
GTCTACCTCGAGAAGGGCAGCCTCTACTCCGAAGACTTTGCTAGCTTGCGTCGTGACTCCTTTGCCAGCTCAGCT
TCCTCCTCCTTCGTCTTCGGCACCGGCCTCCGGAGAGTCGCCGCCGTCGATAACAACGTCATGGCCAGTACCGTC
GAGCGCTCTCGCCATCGCCGCGAGCGCACCTTTGTCGGTAGCGAATGCGCCGTCTGCGAGGAGCCCCTCGAGCAC
ACTCTTCAGGGCGAGCGCATCCTACAATTCTCGTGCTCCCACGTCTCCCACGAGGCCTGCTTCTACGAGTTTATC
CGCGAAGTCGACTCGCAACACTGCCCGACCTGCGATGCCCCGCTGCATCTCGACACCAGCCGCGGCGGCAACGTC
ATCGACATCAACAAGATGAGCACCATGATGCGCAGCGACTCGCGCTCCGCCCACACGCCCACCCCGTCCTGGGAT
AACCAGACCGTTAGGTCACCCAGCATCGGCAGCTCCCACAAGAACCTCCCGGCCCTGCCAGCTCTCCCCGTCCTA
CCGTACGGCCCCGCCCAAAAGGATCTGCCCCGGGGCCACTCCTCCCGAGAGCCCTCCGACCGCTACGGCCCCTCG
AGGCACGACAGCGAGGTCGCCTCGAGCGGATACCCCGAGACGGCCCAGAGCGCGCCCGCCCGTCGCCACGACTAC
GACCTCCAGGCCATGGAGACGTCCCCCGGCAGTCCGCGTCCCATCTCGCGGAACCCGATCCCCCCCCCGACCATC
ACCGTCCGCTCCGAGTTCCCGACTCTCACCAGGTCCCGCCAGCAGCAGACGCTCACCTGCCTCATCACCGTCGAG
GCCGCCAGCAACAAGTGGAGGCCCGACCTCGAGGATCTCGGCGTCCAGCCGCTGCAGGTGCCCTCGCTCGAGGCT
CGGGTGGACGACGCCATGACGCGGCAGCCCGTCGCCATGCCCGCCCCTCTCTATCCCTACGAGTCTGCCGACGTG
CTGGAGGAGATGGCCGAGAACCTGAGGCACCGCGTCGACAGCTGGCACGGGCTCATCGTTGACGATTTCGGGCCC
CTTCGTCTCTACGGCACGCTTCGCGTCGGCAAGAACAAGGTTTCATGGCAGGTCCTGGAATGCTATCTCTTCGCC
AAGATGCTCATCTGCGTCAAGGAGAAGAAGCAGGCGCCGCAGTGGGATGACAACGGCATCCCTCAGAGGACCGCC
ACCGTCTGCACGCTCAAGGGCTCCATCCTCATCAAGAAGCACCTCAACGACGTGGTCGAGACGGGCACCATAGAT
GAGAACGTTCTGACGCTGACGCTGTCTGCTGGTGAACTGCCGCAGTTCCACCTCAAGTTCGACAATCGCAACCAG
CTCAAGCTCTGGAACCAGGCGCTCGTGGACCTCATTACCGTCGACGAGCCCTCGTCCTTCCGCATCTCCGACTAC
GACCACGAAATATCCGAGACGGAAGACGACGTCGACTGGAACCGGTCCCGGTCCAAGCGCGTCTCGTCGACGGCC
TCATCCTGGGGTCCCAAGTCTGCGACGACGGCGCCCACGGAGTACACGTCCTTTACAGCTCGGAGCCCGCGACTG
GGCAGTCCCATGCACGTGCCTATCGACGTGGTGGTGGTGGTGCCCATCTCGTCGTCGATGCAAGGCGTCAAGATC
AACCTGGTACGCGACGCCCTCAAGTTCATGATTGGCAACCTCGGCGAGCGCGACCGGCTCGGCATCGTCACCTTT
GGCTCTGCCAGTGGCGGCACGCCCATGTCGGGAATGATGACCAAGTCATACGCCGACTGGCCCAAGGTGCTGGCC
TCGATCAAGCCCGTCGGCCAGAAGAGCCCGCGGGCGGACGTGGTCGAGGGCGCCAACGTGGCCATGGACCAGCTC
ATGGAGCGCAAGCACAGCAACCCCATCGCCACCATCATGCTCATCAGCGACGCGTCGACGGCTGACCCGGACTCG
GTCGACTTCGTCGTATCCCGCGCCGAGGCTGCCAAGATCACCATCCACTCCTTCGGCCTCGGCACGTCGCACAAG
CCCGACACCATGATTGAGCTGTCGACGCGGACCAAGGCGTCTTACACGTACGTCAAGGACTGGATGATGCTACGC
GAGTGCCTGGCGGGTTGCCTGGGCGGGCTGCAGACGCTGTCGCATCAGAACGTCAAGCTCAAGCTCAAACTCCCC
GAGGGATCGCCGGCCAAGTTTCACAAAATCAGCGGCGCGCTGCAGATTACGAAGCGCGCCACGGGCCGCGACGCC
GAGGCCAGCCTGGGAGACCTGCGCTTCGGCGACAAGCGCGACGTGTTGGTGCAGCTCGTCATCACCCCCGATAGC
ATGTCGCAGGATCAGCTGCCGCAGGACCCGTGGGATAACATCGTCTCCGGACTCGAGGCCCTCGGAGGCTCCGTC
GAGGCCGAGGCCGACCGCATCGCCTCGGTCGAGGAGGTGCCCCTGGTCCAGGCCGACCTCAGCTGGGGCGACATC
CTGCGGGACGGCACAGTGACGCAAATGCCGCGGCCGTCGCTGCTGACGGTGACGGGGCTCCCGGCTCCGACGGGC
CAGAAGAAGGCCTGGGCGACCAACGCGCCGCCTCCGATCCCGCCGCACCCGAGCATCGTTCAGCGGCGCATGGAG
CTATTGACGTCGGACATGCTGACGCGCGCCCTTACGCTCGTAAGCCGCGGCCAGCACGACCGGGCGCATACGCTG
CTCAACGAGACGCGGTCCATCCTCAAGGGCCTCGGCAAGGGCGGTTTGCCACCGGTGCCACCGCCTCGGCTGCCC
ACTCCGCTGCCCAACAGCACCAAGTCGGCGCCTACGACGCCGCACCACGTCGGCGGGGATGCGACGCCTCACGTG
GCCGGAACTCCGGACCGGAAGCGGAGCCCGTCGCCGCCCACGTCGACGGCCTCTTCGACCAGCAGCGGCAACAGC
GGCAACGGCTTCTCGGCCGGCCGGCTCGCCCGCAGCCGATCTACCGATCACCTCGGCGGAGTCGGCAGGGGCATC
GACCCGGGAACGGTGGCGGCGCTCGACGCCGAGCTGGAGAGCAGCCTCGAATGGATCAACCACCCGGCCGTCTTC
GCTCGCGATAGCCGCAAGGCGGTGCTTCAGGCCATCGGCGTAATCAGCTCGCAGCGGGCCTTTACCTTTCGGTCC
CCCATCGAGAGCCTCTGGGCCGGTCGCGTCGGCGGCATCAAGCGACTGGCGGACAAGAGCCGCGAATGGCGAGAG
GAGGGCGGCGGCGAGGGCGGCATCATGGAGGAGGCTTGA
Transcript >Ophcf2|06524
ATGTTCAGTCGCGTTCGACGAAGCCAGCGGCACCGCAGCGGCCACGCGGGTCCCGATCCCAACAAGGGCCCGAAT
TTGTCGACGGACCTGAGCCTAATCGTCGGCAATCCCCAGGGTCCTCCCCGTCCCATGCCACTAGCCAACCAGTCC
GTCTACCTCGAGAAGGGCAGCCTCTACTCCGAAGACTTTGCTAGCTTGCGTCGTGACTCCTTTGCCAGCTCAGCT
TCCTCCTCCTTCGTCTTCGGCACCGGCCTCCGGAGAGTCGCCGCCGTCGATAACAACGTCATGGCCAGTACCGTC
GAGCGCTCTCGCCATCGCCGCGAGCGCACCTTTGTCGGTAGCGAATGCGCCGTCTGCGAGGAGCCCCTCGAGCAC
ACTCTTCAGGGCGAGCGCATCCTACAATTCTCGTGCTCCCACGTCTCCCACGAGGCCTGCTTCTACGAGTTTATC
CGCGAAGTCGACTCGCAACACTGCCCGACCTGCGATGCCCCGCTGCATCTCGACACCAGCCGCGGCGGCAACGTC
ATCGACATCAACAAGATGAGCACCATGATGCGCAGCGACTCGCGCTCCGCCCACACGCCCACCCCGTCCTGGGAT
AACCAGACCGTTAGGTCACCCAGCATCGGCAGCTCCCACAAGAACCTCCCGGCCCTGCCAGCTCTCCCCGTCCTA
CCGTACGGCCCCGCCCAAAAGGATCTGCCCCGGGGCCACTCCTCCCGAGAGCCCTCCGACCGCTACGGCCCCTCG
AGGCACGACAGCGAGGTCGCCTCGAGCGGATACCCCGAGACGGCCCAGAGCGCGCCCGCCCGTCGCCACGACTAC
GACCTCCAGGCCATGGAGACGTCCCCCGGCAGTCCGCGTCCCATCTCGCGGAACCCGATCCCCCCCCCGACCATC
ACCGTCCGCTCCGAGTTCCCGACTCTCACCAGGTCCCGCCAGCAGCAGACGCTCACCTGCCTCATCACCGTCGAG
GCCGCCAGCAACAAGTGGAGGCCCGACCTCGAGGATCTCGGCGTCCAGCCGCTGCAGGTGCCCTCGCTCGAGGCT
CGGGTGGACGACGCCATGACGCGGCAGCCCGTCGCCATGCCCGCCCCTCTCTATCCCTACGAGTCTGCCGACGTG
CTGGAGGAGATGGCCGAGAACCTGAGGCACCGCGTCGACAGCTGGCACGGGCTCATCGTTGACGATTTCGGGCCC
CTTCGTCTCTACGGCACGCTTCGCGTCGGCAAGAACAAGGTTTCATGGCAGGTCCTGGAATGCTATCTCTTCGCC
AAGATGCTCATCTGCGTCAAGGAGAAGAAGCAGGCGCCGCAGTGGGATGACAACGGCATCCCTCAGAGGACCGCC
ACCGTCTGCACGCTCAAGGGCTCCATCCTCATCAAGAAGCACCTCAACGACGTGGTCGAGACGGGCACCATAGAT
GAGAACGTTCTGACGCTGACGCTGTCTGCTGGTGAACTGCCGCAGTTCCACCTCAAGTTCGACAATCGCAACCAG
CTCAAGCTCTGGAACCAGGCGCTCGTGGACCTCATTACCGTCGACGAGCCCTCGTCCTTCCGCATCTCCGACTAC
GACCACGAAATATCCGAGACGGAAGACGACGTCGACTGGAACCGGTCCCGGTCCAAGCGCGTCTCGTCGACGGCC
TCATCCTGGGGTCCCAAGTCTGCGACGACGGCGCCCACGGAGTACACGTCCTTTACAGCTCGGAGCCCGCGACTG
GGCAGTCCCATGCACGTGCCTATCGACGTGGTGGTGGTGGTGCCCATCTCGTCGTCGATGCAAGGCGTCAAGATC
AACCTGGTACGCGACGCCCTCAAGTTCATGATTGGCAACCTCGGCGAGCGCGACCGGCTCGGCATCGTCACCTTT
GGCTCTGCCAGTGGCGGCACGCCCATGTCGGGAATGATGACCAAGTCATACGCCGACTGGCCCAAGGTGCTGGCC
TCGATCAAGCCCGTCGGCCAGAAGAGCCCGCGGGCGGACGTGGTCGAGGGCGCCAACGTGGCCATGGACCAGCTC
ATGGAGCGCAAGCACAGCAACCCCATCGCCACCATCATGCTCATCAGCGACGCGTCGACGGCTGACCCGGACTCG
GTCGACTTCGTCGTATCCCGCGCCGAGGCTGCCAAGATCACCATCCACTCCTTCGGCCTCGGCACGTCGCACAAG
CCCGACACCATGATTGAGCTGTCGACGCGGACCAAGGCGTCTTACACGTACGTCAAGGACTGGATGATGCTACGC
GAGTGCCTGGCGGGTTGCCTGGGCGGGCTGCAGACGCTGTCGCATCAGAACGTCAAGCTCAAGCTCAAACTCCCC
GAGGGATCGCCGGCCAAGTTTCACAAAATCAGCGGCGCGCTGCAGATTACGAAGCGCGCCACGGGCCGCGACGCC
GAGGCCAGCCTGGGAGACCTGCGCTTCGGCGACAAGCGCGACGTGTTGGTGCAGCTCGTCATCACCCCCGATAGC
ATGTCGCAGGATCAGCTGCCGCAGGACCCGTGGGATAACATCGTCTCCGGACTCGAGGCCCTCGGAGGCTCCGTC
GAGGCCGAGGCCGACCGCATCGCCTCGGTCGAGGAGGTGCCCCTGGTCCAGGCCGACCTCAGCTGGGGCGACATC
CTGCGGGACGGCACAGTGACGCAAATGCCGCGGCCGTCGCTGCTGACGGTGACGGGGCTCCCGGCTCCGACGGGC
CAGAAGAAGGCCTGGGCGACCAACGCGCCGCCTCCGATCCCGCCGCACCCGAGCATCGTTCAGCGGCGCATGGAG
CTATTGACGTCGGACATGCTGACGCGCGCCCTTACGCTCGTAAGCCGCGGCCAGCACGACCGGGCGCATACGCTG
CTCAACGAGACGCGGTCCATCCTCAAGGGCCTCGGCAAGGGCGGTTTGCCACCGGTGCCACCGCCTCGGCTGCCC
ACTCCGCTGCCCAACAGCACCAAGTCGGCGCCTACGACGCCGCACCACGTCGGCGGGGATGCGACGCCTCACGTG
GCCGGAACTCCGGACCGGAAGCGGAGCCCGTCGCCGCCCACGTCGACGGCCTCTTCGACCAGCAGCGGCAACAGC
GGCAACGGCTTCTCGGCCGGCCGGCTCGCCCGCAGCCGATCTACCGATCACCTCGGCGGAGTCGGCAGGGGCATC
GACCCGGGAACGGTGGCGGCGCTCGACGCCGAGCTGGAGAGCAGCCTCGAATGGATCAACCACCCGGCCGTCTTC
GCTCGCGATAGCCGCAAGGCGGTGCTTCAGGCCATCGGCGTAATCAGCTCGCAGCGGGCCTTTACCTTTCGGTCC
CCCATCGAGAGCCTCTGGGCCGGTCGCGTCGGCGGCATCAAGCGACTGGCGGACAAGAGCCGCGAATGGCGAGAG
GAGGGCGGCGGCGAGGGCGGCATCATGGAGGAGGCTTGA
Gene >Ophcf2|06524
ATGTTCAGTCGCGTTCGACGAAGCCAGCGGCACCGCAGCGGCCACGCGGGTCCCGATCCCAACAAGGGCCCGAAT
TTGTCGACGGACCTGAGCCTAATCGTCGGCAATCCCCAGGGTCCTCCCCGTCCCATGCCACTAGCCAACCAGTCC
GTCTACCTCGAGAAGGGTAAGTTTTCCCTTGAGCTTCCCGTCGCGCGAGCCGAGCGGCTTTGTTTCACCTGATGC
CGCTTCCCTGTCGCCTCATATCTTTACCTACCTACCTACCTACCGCCTACATACCCCTTTGGCCCTCCCGCTGAC
TCGCCCCCTCCTCAACTGCAGGCAGCCTCTACTCCGAAGACTTTGCTAGCTTGCGTCGTGACTCCTTTGCCAGCT
CAGCTTCCTCCTCCTTCGTCTTCGGCACCGGCCTCCGGAGAGTCGCCGCCGTCGATAACAACGTCATGGCCAGTA
CCGTCGAGCGCTCTCGCCATCGCCGCGAGCGCACCTTTGTCGGTAGCGAATGCGCCGTCTGCGAGGAGCCCCTCG
AGCACACTCTTCAGGGCGAGCGCATCCTACAATTCTCGTGCTCCCACGTCTCCCACGAGGCCTGCTTCTACGAGT
TTATCCGCGAAGTCGACTCGCAACACTGCCCGACCTGCGATGCCCCGCTGCATCTCGACACCAGCCGCGGCGGCA
ACGTCATCGACATCAGTCGGTCCTCCCTCTCTCGCCCTCGCCCTCGCTCCAACGCCCGCTGACGTCGCTCCAGAC
AAGATGAGCACCATGATGCGCAGCGACTCGCGCTCCGCCCACACGCCCACCCCGTCCTGGGATAACCAGACCGTT
AGGTCACCCAGCATCGGCAGCTCCCACAAGAACCTCCCGGCCCTGCCAGCTCTCCCCGTCCTACCGTACGGCCCC
GCCCAAAAGGATCTGCCCCGGGGCCACTCCTCCCGAGAGCCCTCCGACCGCTACGGCCCCTCGAGGCACGACAGC
GAGGTCGCCTCGAGCGGATACCCCGAGACGGCCCAGAGCGCGCCCGCCCGTCGCCACGACTACGACCTCCAGGCC
ATGGAGACGTCCCCCGGCAGTCCGCGTCCCATCTCGCGGAACCCGATCCCCCCCCCGACCATCACCGTCCGCTCC
GAGTTCCCGACTCTCACCAGGTCCCGCCAGCAGCAGACGCTCACCTGCCTCATCACCGTCGAGGCCGCCAGCAAC
AAGTGGAGGCCCGACCTCGAGGATCTCGGCGTCCAGCCGCTGCAGGTGCCCTCGCTCGAGGCTCGGGTGGACGAC
GCCATGACGCGGCAGCCCGTCGCCATGCCCGCCCCTCTCTATCCCTACGAGTCTGCCGACGTGCTGGAGGAGATG
GCCGAGAACCTGAGGCACCGCGTCGACAGCTGGCACGGGCTCATCGTTGACGAGTGAGTTTCCTTGACCCCTTCC
ACGCTCTCCTACCCACGACTGACCTGTCCAAAGTTTCGGGCCCCTTCGTCTCTACGGCACGCTTCGCGTCGGCAA
GAACAAGGTTTCATGGCAGGTCCTGGAATGCTATCTCTTCGCCAAGATGCTCATCTGCGTCAAGGAGAAGAAGCA
GGCGCCGCAGTGGGATGACAACGGCATCCCTCAGAGGACCGCCACCGTCTGCACGCTCAAGGGCTCCATCCTCAT
CAAGAAGCACCTCAACGACGTGGTCGAGACGGGCACCATAGATGAGAACGTTCTGACGCTGACGCTGTCTGCTGG
TGAACTGCCGCAGTTCCACCTCAAGTTCGACAATCGCAACCAGCTCAAGCTCTGGAACCAGGCGCTCGTGGACCT
CATTACCGTCGACGAGCCCTCGTCCTTCCGCATCTCCGACTACGACCACGAAATATCCGAGACGGAAGACGACGT
CGACTGGAACCGGTCCCGGTCCAAGCGCGTCTCGTCGACGGCCTCATCCTGGGGTCCCAAGTCTGCGACGACGGC
GCCCACGGAGTACACGTCCTTTACAGCTCGGAGCCCGCGACTGGGCAGTCCCATGCACGTGCCTATCGACGTGGT
GGTGGTGGTGCCCATCTCGTCGTCGATGCAAGGCGTCAAGATCAACCTGGTACGCGACGCCCTCAAGTTCATGAT
TGGCAACCTCGGCGAGCGCGACCGGCTCGGCATCGTCACCTTTGGCTCTGCCAGTGGCGGCACGCCCATGTCGGG
AATGATGACCAAGTCATACGCCGACTGGCCCAAGGTGCTGGCCTCGATCAAGCCCGTCGGCCAGAAGAGCCCGCG
GGCGGACGTGGTCGAGGGCGCCAACGTGGCCATGGACCAGCTCATGGAGCGCAAGCACAGCAACCCCATCGCCAC
CATCATGCTCATCAGCGACGCGTCGACGGCTGACCCGGACTCGGTCGACTTCGTCGTATCCCGCGCCGAGGCTGC
CAAGATCACCATCCACTCCTTCGGCCTCGGCACGTCGCACAAGCCCGACACCATGATTGAGCTGTCGACGCGGAC
CAAGGCGTCTTACACGTACGTCAAGGACTGGATGATGCTACGCGAGTGCCTGGCGGGTTGCCTGGGCGGGCTGCA
GACGCTGTCGCATCAGAACGTCAAGCTCAAGCTCAAACTCCCCGAGGGATCGCCGGCCAAGTTTCACAAAATCAG
CGGCGCGCTGCAGATTACGAAGCGCGCCACGGGCCGCGACGCCGAGGCCAGCCTGGGAGACCTGCGCTTCGGCGA
CAAGCGCGACGTGTTGGTGCAGCTCGTCATCACCCCCGATAGCATGTCGCAGGATCAGCTGCCGCAGGACCCGTG
GGATAACATCGTCTCCGGACTCGAGGCCCTCGGAGGCTCCGTCGAGGCCGAGGCCGACCGCATCGCCTCGGTCGA
GGAGGTGCCCCTGGTCCAGGCCGACCTCAGCTGGGGCGACATCCTGCGGGACGGCACAGTGACGCAAATGCCGCG
GCCGTCGCTGCTGACGGTGACGGGGCTCCCGGCTCCGACGGGCCAGAAGAAGGCCTGGGCGACCAACGCGCCGCC
TCCGATCCCGCCGCACCCGAGCATCGTTCAGCGGCGCATGGAGCTATTGACGTCGGACATGCTGACGCGCGCCCT
TACGCTCGTAAGCCGCGGCCAGCACGACCGGGCGCATACGCTGCTCAACGAGACGCGGTCCATCCTCAAGGGCCT
CGGCAAGGGCGGTTTGCCACCGGTGCCACCGCCTCGGCTGCCCACTCCGCTGCCCAACAGCACCAAGTCGGCGCC
TACGACGCCGCACCACGTCGGCGGGGATGCGACGCCTCACGTGGCCGGAACTCCGGACCGGAAGCGGAGCCCGTC
GCCGCCCACGTCGACGGCCTCTTCGACCAGCAGCGGCAACAGCGGCAACGGCTTCTCGGCCGGCCGGCTCGCCCG
CAGCCGATCTACCGATCACCTCGGCGGAGTCGGCAGGGGCATCGACCCGGGAACGGTGGCGGCGCTCGACGCCGA
GCTGGAGAGCAGCCTCGAATGGATCAACCACCCGGCCGTCTTCGCTCGCGATAGCCGCAAGGCGGTGCTTCAGGC
CATCGGCGTAATCAGCTCGCAGCGGGCCTTTACCTTTCGGTCCCCCATCGAGAGCCTCTGGGCCGGTCGCGTCGG
CGGCATCAAGCGACTGGCGGACAAGAGCCGCGAATGGCGAGAGGAGGGCGGCGGCGAGGGCGGCATCATGGAGGA
GGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail