Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06521
Gene name
Locationscaffold_08:335781..337689
Strand+
Gene length (bp)1908
Transcript length (bp)1854
Coding sequence length (bp)1854
Protein length (aa) 618

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03441 FAD_binding_7 FAD binding domain of DNA photolyase 1.3E-75 317 545
PF00875 DNA_photolyase DNA photolyase 1.7E-38 6 174

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2538 0.8774 0.3157 0.0373 0.2379 0.0283 0.1007 0.0122 0.0434 0.0079

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3746
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1312
Ophiocordyceps australis map64 (Brazil) OphauB2|5172
Ophiocordyceps camponoti-floridani Ophcf2|06521 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6518
Ophiocordyceps kimflemingae Ophio5|4382
Ophiocordyceps subramaniannii Hirsu2|7302

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06521
MTKPRVIYWFRTDLRLHDSPALKAALDLEPAVLWPIFTWDPHYVYRKKGGLNRWQFLLDCQNDLSRSITKRNSAS
KLFVLREAPQTILPKLFAAWNVTHLVFEKDTDSYARERDEAVTEAANKAGVEVIVRSGRTLWDSEGIVANNGGKP
TMSMSQLRAAGAKVGDIPRPLPAPEKLPGPGDMPVDFDHDTPGAEPDINSGFRTGKVTVYGQVAGPKGDFAIETM
EELGFPPATTPHRGGESLALKRLAEIVDDAKYTATFEKPKTSPAQFEPQSTTLLSPFLHFGALSVREFYWRVQDV
VDSFGKGASSPPASLTGQLLFRDMYFAAQAAVGPNFVQTAGNAHCRFVPWHLPSKRDPETGLVTGEYHVDSEEAD
VWFDRWQKGVTGFPWVDALMRQLREEGWIHHLGRHSLACFLTRGGCYVDWERGADVFEELLLDHEPACNAGNWQW
LSCTAFFNQYFRCYSPISFGKKWDKNGDFIRRWVPELKDMDARHIYEPWKAPIPDQKKAGVRITGDGVSGSDKGT
YPKPMFDFSHRRDVCIGAMKKAYEVGLHGNDQRVLNGGWRELFPDPGESEVRGELESDDGEHADDANQEASAGIK
RHARKSSTEKTTKKQKK*
Coding >Ophcf2|06521
ATGACCAAGCCTCGCGTCATCTATTGGTTCCGGACCGACCTCCGTCTTCACGATTCGCCTGCCCTCAAGGCTGCC
CTCGACCTGGAGCCAGCCGTGCTCTGGCCCATCTTCACCTGGGACCCTCACTACGTCTACCGCAAAAAGGGAGGC
CTGAACCGGTGGCAATTCCTACTGGACTGCCAGAATGATCTCTCCCGCTCCATCACCAAGCGTAACTCGGCCTCC
AAGCTCTTCGTCCTAAGGGAAGCTCCGCAGACGATCCTACCCAAGCTCTTCGCTGCCTGGAACGTCACCCACCTT
GTCTTCGAAAAGGACACGGACAGCTATGCGCGTGAGAGAGACGAGGCCGTCACGGAAGCCGCCAATAAGGCCGGC
GTCGAGGTCATCGTCCGCTCAGGGAGAACCCTTTGGGACAGCGAAGGCATCGTGGCCAACAACGGCGGCAAGCCA
ACCATGTCTATGTCCCAGCTCCGGGCCGCCGGCGCCAAGGTGGGCGATATCCCGCGTCCGCTGCCGGCGCCGGAG
AAGCTCCCGGGTCCGGGCGACATGCCCGTCGACTTCGACCACGACACGCCCGGCGCCGAGCCCGACATCAACTCC
GGCTTCCGCACCGGTAAAGTCACCGTCTACGGACAAGTCGCCGGTCCCAAGGGCGACTTTGCTATTGAGACTATG
GAGGAGCTGGGCTTCCCGCCCGCCACGACGCCTCATCGCGGTGGTGAGAGCCTCGCCCTGAAACGGCTGGCTGAA
ATCGTAGACGACGCAAAGTATACGGCCACGTTCGAGAAGCCCAAGACCAGCCCGGCCCAGTTCGAGCCTCAGTCG
ACGACGCTGCTATCACCATTCCTCCACTTCGGCGCCCTCTCCGTTCGCGAGTTCTACTGGCGCGTCCAGGACGTC
GTCGATTCCTTCGGCAAGGGAGCATCATCACCCCCTGCCAGCCTCACCGGTCAGCTGCTCTTCCGCGACATGTAC
TTTGCCGCTCAGGCGGCGGTTGGCCCCAACTTCGTTCAGACGGCCGGTAACGCTCACTGCCGCTTCGTTCCCTGG
CATCTGCCTTCCAAGCGCGATCCCGAGACCGGCCTGGTGACGGGCGAGTACCACGTTGACTCGGAAGAGGCGGAC
GTCTGGTTCGACCGCTGGCAGAAGGGTGTCACCGGCTTTCCTTGGGTCGACGCTCTCATGCGCCAGCTTCGCGAG
GAGGGCTGGATTCATCATCTCGGCCGTCACTCCCTTGCCTGCTTTCTCACTCGCGGCGGCTGCTATGTCGACTGG
GAGCGTGGCGCTGACGTCTTTGAGGAGTTGCTCCTCGACCACGAGCCCGCCTGTAACGCGGGCAACTGGCAATGG
CTGTCCTGCACCGCCTTCTTCAACCAGTATTTCCGCTGTTACAGTCCAATATCATTCGGCAAGAAGTGGGATAAG
AACGGCGACTTCATCCGCCGCTGGGTGCCCGAGCTGAAAGACATGGACGCCCGCCACATCTACGAGCCGTGGAAG
GCGCCCATCCCGGACCAGAAGAAAGCCGGCGTGCGCATCACGGGCGACGGCGTGTCCGGAAGCGACAAAGGGACC
TATCCGAAGCCCATGTTCGACTTCTCCCATCGCCGTGACGTCTGCATTGGCGCCATGAAGAAGGCGTACGAAGTC
GGTCTGCACGGAAACGACCAACGTGTCCTCAACGGCGGATGGCGGGAATTGTTCCCTGATCCGGGCGAGTCCGAG
GTCCGGGGCGAGCTCGAGAGTGACGATGGTGAGCATGCCGATGATGCGAATCAAGAGGCATCGGCCGGCATCAAA
CGGCATGCGAGAAAATCGAGCACTGAGAAGACGACGAAGAAACAAAAAAAGTAG
Transcript >Ophcf2|06521
ATGACCAAGCCTCGCGTCATCTATTGGTTCCGGACCGACCTCCGTCTTCACGATTCGCCTGCCCTCAAGGCTGCC
CTCGACCTGGAGCCAGCCGTGCTCTGGCCCATCTTCACCTGGGACCCTCACTACGTCTACCGCAAAAAGGGAGGC
CTGAACCGGTGGCAATTCCTACTGGACTGCCAGAATGATCTCTCCCGCTCCATCACCAAGCGTAACTCGGCCTCC
AAGCTCTTCGTCCTAAGGGAAGCTCCGCAGACGATCCTACCCAAGCTCTTCGCTGCCTGGAACGTCACCCACCTT
GTCTTCGAAAAGGACACGGACAGCTATGCGCGTGAGAGAGACGAGGCCGTCACGGAAGCCGCCAATAAGGCCGGC
GTCGAGGTCATCGTCCGCTCAGGGAGAACCCTTTGGGACAGCGAAGGCATCGTGGCCAACAACGGCGGCAAGCCA
ACCATGTCTATGTCCCAGCTCCGGGCCGCCGGCGCCAAGGTGGGCGATATCCCGCGTCCGCTGCCGGCGCCGGAG
AAGCTCCCGGGTCCGGGCGACATGCCCGTCGACTTCGACCACGACACGCCCGGCGCCGAGCCCGACATCAACTCC
GGCTTCCGCACCGGTAAAGTCACCGTCTACGGACAAGTCGCCGGTCCCAAGGGCGACTTTGCTATTGAGACTATG
GAGGAGCTGGGCTTCCCGCCCGCCACGACGCCTCATCGCGGTGGTGAGAGCCTCGCCCTGAAACGGCTGGCTGAA
ATCGTAGACGACGCAAAGTATACGGCCACGTTCGAGAAGCCCAAGACCAGCCCGGCCCAGTTCGAGCCTCAGTCG
ACGACGCTGCTATCACCATTCCTCCACTTCGGCGCCCTCTCCGTTCGCGAGTTCTACTGGCGCGTCCAGGACGTC
GTCGATTCCTTCGGCAAGGGAGCATCATCACCCCCTGCCAGCCTCACCGGTCAGCTGCTCTTCCGCGACATGTAC
TTTGCCGCTCAGGCGGCGGTTGGCCCCAACTTCGTTCAGACGGCCGGTAACGCTCACTGCCGCTTCGTTCCCTGG
CATCTGCCTTCCAAGCGCGATCCCGAGACCGGCCTGGTGACGGGCGAGTACCACGTTGACTCGGAAGAGGCGGAC
GTCTGGTTCGACCGCTGGCAGAAGGGTGTCACCGGCTTTCCTTGGGTCGACGCTCTCATGCGCCAGCTTCGCGAG
GAGGGCTGGATTCATCATCTCGGCCGTCACTCCCTTGCCTGCTTTCTCACTCGCGGCGGCTGCTATGTCGACTGG
GAGCGTGGCGCTGACGTCTTTGAGGAGTTGCTCCTCGACCACGAGCCCGCCTGTAACGCGGGCAACTGGCAATGG
CTGTCCTGCACCGCCTTCTTCAACCAGTATTTCCGCTGTTACAGTCCAATATCATTCGGCAAGAAGTGGGATAAG
AACGGCGACTTCATCCGCCGCTGGGTGCCCGAGCTGAAAGACATGGACGCCCGCCACATCTACGAGCCGTGGAAG
GCGCCCATCCCGGACCAGAAGAAAGCCGGCGTGCGCATCACGGGCGACGGCGTGTCCGGAAGCGACAAAGGGACC
TATCCGAAGCCCATGTTCGACTTCTCCCATCGCCGTGACGTCTGCATTGGCGCCATGAAGAAGGCGTACGAAGTC
GGTCTGCACGGAAACGACCAACGTGTCCTCAACGGCGGATGGCGGGAATTGTTCCCTGATCCGGGCGAGTCCGAG
GTCCGGGGCGAGCTCGAGAGTGACGATGGTGAGCATGCCGATGATGCGAATCAAGAGGCATCGGCCGGCATCAAA
CGGCATGCGAGAAAATCGAGCACTGAGAAGACGACGAAGAAACAAAAAAAGTAG
Gene >Ophcf2|06521
ATGACCAAGCCTCGCGTCATCTATTGGTTCCGGACCGACCTCCGTCTTCACGATTCGCCTGCCCTCAAGGCTGCC
CTCGACCTGGAGCCAGCCGTGCTCTGGCCCATCTTCACCTGGGACCCTCACTACGTCTACCGCAAAAAGGGAGGC
CTGAACCGGTGGCAATTCCTGTGAGGCCGTCGTCTCCCCCGCTGAAACTGCCCTTCTGATGTAGTATGACAAAGA
CTGGACTGCCAGAATGATCTCTCCCGCTCCATCACCAAGCGTAACTCGGCCTCCAAGCTCTTCGTCCTAAGGGAA
GCTCCGCAGACGATCCTACCCAAGCTCTTCGCTGCCTGGAACGTCACCCACCTTGTCTTCGAAAAGGACACGGAC
AGCTATGCGCGTGAGAGAGACGAGGCCGTCACGGAAGCCGCCAATAAGGCCGGCGTCGAGGTCATCGTCCGCTCA
GGGAGAACCCTTTGGGACAGCGAAGGCATCGTGGCCAACAACGGCGGCAAGCCAACCATGTCTATGTCCCAGCTC
CGGGCCGCCGGCGCCAAGGTGGGCGATATCCCGCGTCCGCTGCCGGCGCCGGAGAAGCTCCCGGGTCCGGGCGAC
ATGCCCGTCGACTTCGACCACGACACGCCCGGCGCCGAGCCCGACATCAACTCCGGCTTCCGCACCGGTAAAGTC
ACCGTCTACGGACAAGTCGCCGGTCCCAAGGGCGACTTTGCTATTGAGACTATGGAGGAGCTGGGCTTCCCGCCC
GCCACGACGCCTCATCGCGGTGGTGAGAGCCTCGCCCTGAAACGGCTGGCTGAAATCGTAGACGACGCAAAGTAT
ACGGCCACGTTCGAGAAGCCCAAGACCAGCCCGGCCCAGTTCGAGCCTCAGTCGACGACGCTGCTATCACCATTC
CTCCACTTCGGCGCCCTCTCCGTTCGCGAGTTCTACTGGCGCGTCCAGGACGTCGTCGATTCCTTCGGCAAGGGA
GCATCATCACCCCCTGCCAGCCTCACCGGTCAGCTGCTCTTCCGCGACATGTACTTTGCCGCTCAGGCGGCGGTT
GGCCCCAACTTCGTTCAGACGGCCGGTAACGCTCACTGCCGCTTCGTTCCCTGGCATCTGCCTTCCAAGCGCGAT
CCCGAGACCGGCCTGGTGACGGGCGAGTACCACGTTGACTCGGAAGAGGCGGACGTCTGGTTCGACCGCTGGCAG
AAGGGTGTCACCGGCTTTCCTTGGGTCGACGCTCTCATGCGCCAGCTTCGCGAGGAGGGCTGGATTCATCATCTC
GGCCGTCACTCCCTTGCCTGCTTTCTCACTCGCGGCGGCTGCTATGTCGACTGGGAGCGTGGCGCTGACGTCTTT
GAGGAGTTGCTCCTCGACCACGAGCCCGCCTGTAACGCGGGCAACTGGCAATGGCTGTCCTGCACCGCCTTCTTC
AACCAGTATTTCCGCTGTTACAGTCCAATATCATTCGGCAAGAAGTGGGATAAGAACGGCGACTTCATCCGCCGC
TGGGTGCCCGAGCTGAAAGACATGGACGCCCGCCACATCTACGAGCCGTGGAAGGCGCCCATCCCGGACCAGAAG
AAAGCCGGCGTGCGCATCACGGGCGACGGCGTGTCCGGAAGCGACAAAGGGACCTATCCGAAGCCCATGTTCGAC
TTCTCCCATCGCCGTGACGTCTGCATTGGCGCCATGAAGAAGGCGTACGAAGTCGGTCTGCACGGAAACGACCAA
CGTGTCCTCAACGGCGGATGGCGGGAATTGTTCCCTGATCCGGGCGAGTCCGAGGTCCGGGGCGAGCTCGAGAGT
GACGATGGTGAGCATGCCGATGATGCGAATCAAGAGGCATCGGCCGGCATCAAACGGCATGCGAGAAAATCGAGC
ACTGAGAAGACGACGAAGAAACAAAAAAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail