Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06520
Gene name
Locationscaffold_08:332220..333534
Strand-
Gene length (bp)1314
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 39 61 22
3 74 96 22
4 116 138 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 61.49 34.78 88.21
Alive In ants, during behavior modification 52.93 29.37 76.49
Dead In ants, recently dead 48.75 27.01 70.49

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.489003 no
Alive Dead 0.679695 no
Dead Fungus 0.250395 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06520
MSRAAWPVLGSTLALLATSTVLCLQINIVVNTTASPLRPATAVAGSLQFFVLAILWWLAVSRILHTGRATHPNLT
FGLGLFACALAAAVSAASLVYLRNAGAESEAVAQLQTRLLVATSVAVTFATGLQLASIISHFIASREPASLKREA
SEMPAEQPTRRLRRIKSIPYSQTKSSGDETAQEKMASPPLPPSPVVTTTPKGFVFTSPFARAVRSSSFKQKSTAP
KKQRRRASEDSDIRRTSLQGSSFDSWDTSSVDIHNRQVVLEMSTPSSAKQQSLETIPASPSHSRRSSVGSPTDPG
FPQSLRTSRSLSHGTLKHREEARPTPASSIHELHIHPLFRSDSQDPPPLASPGTSVVASPIAGQVITRRESSKSL
GGMLSGSTSGLHSPLAHQTCFESSEPTPDGSHASEEDSEGERPTTAPVPPWLLTQERDQSDE*
Coding >Ophcf2|06520
ATGTCTCGCGCCGCCTGGCCTGTCCTCGGCAGCACCTTGGCCCTGCTCGCAACGTCGACGGTCCTGTGTCTGCAG
ATCAACATCGTCGTCAACACCACGGCCTCTCCCCTGAGGCCCGCAACCGCCGTCGCCGGCTCTCTGCAGTTTTTC
GTCCTAGCCATCCTCTGGTGGCTCGCCGTGTCTCGCATCTTGCACACCGGCAGAGCGACACATCCCAACCTCACC
TTTGGCCTGGGCCTTTTCGCCTGCGCACTCGCCGCCGCCGTCTCCGCCGCGTCTTTGGTATACCTGCGCAACGCC
GGTGCCGAGTCGGAGGCCGTTGCCCAACTCCAGACCCGACTTCTGGTGGCCACCTCGGTCGCCGTGACGTTTGCC
ACTGGTCTCCAGCTCGCCTCCATCATCTCTCACTTCATCGCGTCTCGGGAGCCTGCCTCTCTTAAGCGAGAAGCT
TCCGAGATGCCGGCCGAACAACCCACAAGACGGCTGCGTCGCATCAAGTCGATCCCATACAGCCAGACCAAGAGT
AGCGGTGACGAGACGGCGCAGGAAAAAATGGCATCGCCTCCCCTGCCCCCGTCACCCGTCGTCACCACGACGCCC
AAGGGCTTCGTCTTCACTTCTCCCTTTGCCCGAGCCGTACGGTCGAGCTCATTCAAGCAAAAGTCGACAGCGCCC
AAGAAGCAGCGACGGCGGGCTTCCGAAGATTCAGACATCCGGAGGACAAGCCTCCAAGGGTCTTCGTTCGATTCG
TGGGATACGTCCTCGGTCGATATCCACAACCGACAGGTGGTGCTGGAGATGTCGACTCCTTCGTCAGCAAAGCAG
CAGAGCCTCGAGACTATTCCCGCCAGTCCGTCGCACAGCCGGAGGTCGAGCGTGGGGAGCCCAACTGACCCCGGC
TTTCCTCAGTCGTTGCGCACCAGCCGAAGCCTAAGCCATGGCACGCTGAAGCATCGAGAGGAAGCTCGACCTACG
CCCGCGAGCTCCATTCACGAGCTTCACATCCATCCGCTGTTTCGATCCGACTCGCAGGACCCACCACCGCTGGCA
TCGCCCGGGACCAGCGTCGTGGCGTCGCCCATCGCAGGGCAGGTCATCACGCGTCGCGAAAGCAGCAAATCTCTC
GGCGGGATGCTCAGTGGCAGTACATCGGGATTGCACAGCCCGCTAGCCCATCAAACTTGCTTCGAAAGCTCGGAG
CCGACGCCGGACGGCTCTCACGCGTCGGAAGAGGATAGCGAGGGGGAACGACCGACAACGGCTCCTGTGCCTCCG
TGGCTGCTGACTCAGGAGCGCGACCAGAGCGATGAGTGA
Transcript >Ophcf2|06520
ATGTCTCGCGCCGCCTGGCCTGTCCTCGGCAGCACCTTGGCCCTGCTCGCAACGTCGACGGTCCTGTGTCTGCAG
ATCAACATCGTCGTCAACACCACGGCCTCTCCCCTGAGGCCCGCAACCGCCGTCGCCGGCTCTCTGCAGTTTTTC
GTCCTAGCCATCCTCTGGTGGCTCGCCGTGTCTCGCATCTTGCACACCGGCAGAGCGACACATCCCAACCTCACC
TTTGGCCTGGGCCTTTTCGCCTGCGCACTCGCCGCCGCCGTCTCCGCCGCGTCTTTGGTATACCTGCGCAACGCC
GGTGCCGAGTCGGAGGCCGTTGCCCAACTCCAGACCCGACTTCTGGTGGCCACCTCGGTCGCCGTGACGTTTGCC
ACTGGTCTCCAGCTCGCCTCCATCATCTCTCACTTCATCGCGTCTCGGGAGCCTGCCTCTCTTAAGCGAGAAGCT
TCCGAGATGCCGGCCGAACAACCCACAAGACGGCTGCGTCGCATCAAGTCGATCCCATACAGCCAGACCAAGAGT
AGCGGTGACGAGACGGCGCAGGAAAAAATGGCATCGCCTCCCCTGCCCCCGTCACCCGTCGTCACCACGACGCCC
AAGGGCTTCGTCTTCACTTCTCCCTTTGCCCGAGCCGTACGGTCGAGCTCATTCAAGCAAAAGTCGACAGCGCCC
AAGAAGCAGCGACGGCGGGCTTCCGAAGATTCAGACATCCGGAGGACAAGCCTCCAAGGGTCTTCGTTCGATTCG
TGGGATACGTCCTCGGTCGATATCCACAACCGACAGGTGGTGCTGGAGATGTCGACTCCTTCGTCAGCAAAGCAG
CAGAGCCTCGAGACTATTCCCGCCAGTCCGTCGCACAGCCGGAGGTCGAGCGTGGGGAGCCCAACTGACCCCGGC
TTTCCTCAGTCGTTGCGCACCAGCCGAAGCCTAAGCCATGGCACGCTGAAGCATCGAGAGGAAGCTCGACCTACG
CCCGCGAGCTCCATTCACGAGCTTCACATCCATCCGCTGTTTCGATCCGACTCGCAGGACCCACCACCGCTGGCA
TCGCCCGGGACCAGCGTCGTGGCGTCGCCCATCGCAGGGCAGGTCATCACGCGTCGCGAAAGCAGCAAATCTCTC
GGCGGGATGCTCAGTGGCAGTACATCGGGATTGCACAGCCCGCTAGCCCATCAAACTTGCTTCGAAAGCTCGGAG
CCGACGCCGGACGGCTCTCACGCGTCGGAAGAGGATAGCGAGGGGGAACGACCGACAACGGCTCCTGTGCCTCCG
TGGCTGCTGACTCAGGAGCGCGACCAGAGCGATGAGTGA
Gene >Ophcf2|06520
ATGTCTCGCGCCGCCTGGCCTGTCCTCGGCAGCACCTTGGCCCTGCTCGCAACGTCGACGGTCCTGTGTCTGCAG
ATCAACATCGTCGTCAACACCACGGCCTCTCCCCTGAGGCCCGCAACCGCCGTCGCCGGCTCTCTGCAGTTTTTC
GTCCTAGCCATCCTCTGGTGGCTCGCCGTGTCTCGCATCTTGCACACCGGCAGAGCGACACATCCCAACCTCACC
TTTGGCCTGGGCCTTTTCGCCTGCGCACTCGCCGCCGCCGTCTCCGCCGCGTCTTTGGTATACCTGCGCAACGCC
GGTGCCGAGTCGGAGGCCGTTGCCCAACTCCAGACCCGACTTCTGGTGGCCACCTCGGTCGCCGTGACGTTTGCC
ACTGGTCTCCAGCTCGCCTCCATCATCTCTCACTTCATCGCGTCTCGGGAGCCTGCCTCTCTTAAGCGAGAAGCT
TCCGAGATGCCGGCCGAACAACCCACAAGACGGCTGCGTCGCATCAAGTCGATCCCATACAGCCAGACCAAGAGT
AGCGGTGACGAGACGGCGCAGGAAAAAATGGCATCGCCTCCCCTGCCCCCGTCACCCGTCGTCACCACGACGCCC
AAGGGCTTCGTCTTCACTTCTCCCTTTGCCCGAGCCGTACGGTCGAGCTCATTCAAGCAAAAGTCGACAGCGCCC
AAGAAGCAGCGACGGCGGGCTTCCGAAGATTCAGACATCCGGAGGACAAGCCTCCAAGGGTCTTCGTTCGATTCG
TGGGATACGTCCTCGGTCGATATCCACAACCGACAGGTGGTGCTGGAGATGTCGACTCCTTCGTCAGCAAAGCAG
CAGAGCCTCGAGACTATTCCCGCCAGTCCGTCGCACAGCCGGAGGTCGAGCGTGGGGAGCCCAACTGACCCCGGC
TTTCCTCAGTCGTTGCGCACCAGCCGAAGCCTAAGCCATGGCACGCTGAAGCATCGAGAGGAAGCTCGACCTACG
CCCGCGAGCTCCATTCACGAGCTTCACATCCATCCGCTGTTTCGATCCGACTCGCAGGACCCACCACCGCTGGCA
TCGCCCGGGACCAGCGTCGTGGCGTCGCCCATCGCAGGGCAGGTCATCACGCGTCGCGAAAGCAGCAAATCTCTC
GGCGGGATGCTCAGTGGCAGTACATCGGGATTGCACAGCCCGCTAGCCCATCAAACTTGCTTCGAAAGCTCGGAG
CCGACGCCGGACGGCTCTCACGCGTCGGAAGAGGATAGCGAGGGGGAACGACCGACAACGGCTCCTGTGCCTCCG
TGGCTGCTGACTCAGGAGCGCGACCAGAGCGATGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail