Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06519
Gene name
Locationscaffold_08:329980..331457
Strand-
Gene length (bp)1477
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00627 UBA UBA/TS-N domain 3.6E-11 140 174
PF00627 UBA UBA/TS-N domain 2.2E-13 333 368
PF09280 XPC-binding XPC-binding domain 1.0E-24 258 313
PF00240 ubiquitin Ubiquitin family 3.9E-19 3 73
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 1.8E-08 1 64

GO

GO Term Description Terminal node
GO:0006289 nucleotide-excision repair Yes
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Yes
GO:0005515 protein binding Yes
GO:0003684 damaged DNA binding Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0050896 response to stimulus No
GO:0043170 macromolecule metabolic process No
GO:0006259 DNA metabolic process No
GO:0010498 proteasomal protein catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0051716 cellular response to stimulus No
GO:0005488 binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0009056 catabolic process No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0044248 cellular catabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:0006508 proteolysis No
GO:0008150 biological_process No
GO:1901575 organic substance catabolic process No
GO:0006281 DNA repair No
GO:0006950 response to stress No
GO:0006974 cellular response to DNA damage stimulus No
GO:0003677 DNA binding No
GO:0090304 nucleic acid metabolic process No
GO:0019538 protein metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0003674 molecular_function No
GO:0030163 protein catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6787 0.8216 0.025 0.0194 0.1173 0.0064 0.2267 0.1036 0.0994 0.0263

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3671
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1314
Ophiocordyceps australis map64 (Brazil) OphauB2|5170
Ophiocordyceps camponoti-floridani Ophcf2|06519 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6659
Ophiocordyceps kimflemingae Ophio5|6604
Ophiocordyceps subramaniannii Hirsu2|7096

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06519
MKITFRDLKQQKFSLDVEPTDLVSTLKEKISADKSWDPKHVKLIYSGKILKDDETVESYNIEEKGFVVCMVNKPK
EKPPVAPSNPAAESSAAPSTAPAASSQSASAQATAPATPTPSRSADTPAAGAGDSSGLAMGAQRAEAITNMEAMG
FERSQIEAAMRAAFNNPDRAVEYILNGIPENIQQEQQQRAAPAAAAPAPASTQAAPEAQGSDDDGGINLFDLAAQ
QGGGTGASRGGGGASAAAAAAAAAAQGGDLGNLDFLRHNPQFQQLRQVVQQQPQMLEPILQQLGAGNPHLAQLIA
AHPDQFLQLLGEDVDDDVPLPPGAQAISVTEEERDAIERLCRLGFDRDQAIQAYFACDKNEELAANFLFDQPEDD
EPSAN*
Coding >Ophcf2|06519
ATGAAGATCACATTTCGGGATTTGAAGCAGCAAAAATTTTCTCTCGATGTCGAGCCCACGGACTTGGTCTCTACC
CTCAAGGAGAAGATTTCGGCCGACAAGAGCTGGGACCCCAAACATGTGAAGCTCATCTACTCCGGCAAAATCCTC
AAGGATGATGAGACTGTTGAATCCTACAACATTGAAGAGAAAGGCTTCGTCGTTTGCATGGTGAACAAGCCCAAG
GAAAAGCCTCCAGTTGCCCCATCGAATCCTGCTGCCGAGTCCTCCGCCGCGCCCTCAACGGCGCCTGCTGCGTCT
TCTCAGTCCGCTTCGGCCCAGGCGACGGCGCCCGCTACCCCGACGCCTTCACGCTCCGCTGACACGCCAGCTGCA
GGTGCTGGTGATTCGTCTGGTCTCGCCATGGGCGCTCAGCGCGCCGAGGCCATCACCAATATGGAAGCCATGGGT
TTTGAGAGGTCCCAGATCGAGGCTGCGATGCGGGCCGCCTTCAACAACCCCGATCGAGCTGTCGAATACATCCTT
AATGGAATCCCCGAAAACATTCAGCAGGAGCAACAGCAACGCGCTGCCCCCGCCGCCGCAGCTCCTGCTCCCGCC
TCCACCCAAGCAGCTCCCGAGGCCCAAGGAAGCGACGACGACGGCGGCATCAACCTCTTCGATCTGGCTGCCCAA
CAGGGTGGTGGGACCGGGGCGTCCCGAGGCGGCGGAGGCGCTTCCGCTGCTGCTGCTGCTGCCGCTGCCGCCGCT
CAGGGCGGAGATCTCGGCAATCTGGACTTCCTGAGACATAACCCGCAGTTCCAGCAGCTCCGCCAAGTCGTCCAG
CAACAGCCTCAGATGCTGGAACCTATCCTGCAGCAGCTCGGGGCAGGGAACCCGCACCTGGCTCAGCTCATCGCC
GCCCACCCCGACCAGTTCCTTCAGCTTCTCGGAGAGGACGTCGACGATGATGTGCCTCTGCCCCCCGGCGCGCAG
GCTATCTCAGTGACGGAAGAAGAGCGCGATGCCATAGAACGGTTATGTAGGCTAGGCTTCGATCGAGACCAGGCC
ATTCAAGCCTACTTCGCCTGCGACAAAAATGAGGAGCTCGCGGCCAACTTCCTCTTCGATCAGCCCGAAGACGAC
GAACCCTCTGCAAATTGA
Transcript >Ophcf2|06519
ATGAAGATCACATTTCGGGATTTGAAGCAGCAAAAATTTTCTCTCGATGTCGAGCCCACGGACTTGGTCTCTACC
CTCAAGGAGAAGATTTCGGCCGACAAGAGCTGGGACCCCAAACATGTGAAGCTCATCTACTCCGGCAAAATCCTC
AAGGATGATGAGACTGTTGAATCCTACAACATTGAAGAGAAAGGCTTCGTCGTTTGCATGGTGAACAAGCCCAAG
GAAAAGCCTCCAGTTGCCCCATCGAATCCTGCTGCCGAGTCCTCCGCCGCGCCCTCAACGGCGCCTGCTGCGTCT
TCTCAGTCCGCTTCGGCCCAGGCGACGGCGCCCGCTACCCCGACGCCTTCACGCTCCGCTGACACGCCAGCTGCA
GGTGCTGGTGATTCGTCTGGTCTCGCCATGGGCGCTCAGCGCGCCGAGGCCATCACCAATATGGAAGCCATGGGT
TTTGAGAGGTCCCAGATCGAGGCTGCGATGCGGGCCGCCTTCAACAACCCCGATCGAGCTGTCGAATACATCCTT
AATGGAATCCCCGAAAACATTCAGCAGGAGCAACAGCAACGCGCTGCCCCCGCCGCCGCAGCTCCTGCTCCCGCC
TCCACCCAAGCAGCTCCCGAGGCCCAAGGAAGCGACGACGACGGCGGCATCAACCTCTTCGATCTGGCTGCCCAA
CAGGGTGGTGGGACCGGGGCGTCCCGAGGCGGCGGAGGCGCTTCCGCTGCTGCTGCTGCTGCCGCTGCCGCCGCT
CAGGGCGGAGATCTCGGCAATCTGGACTTCCTGAGACATAACCCGCAGTTCCAGCAGCTCCGCCAAGTCGTCCAG
CAACAGCCTCAGATGCTGGAACCTATCCTGCAGCAGCTCGGGGCAGGGAACCCGCACCTGGCTCAGCTCATCGCC
GCCCACCCCGACCAGTTCCTTCAGCTTCTCGGAGAGGACGTCGACGATGATGTGCCTCTGCCCCCCGGCGCGCAG
GCTATCTCAGTGACGGAAGAAGAGCGCGATGCCATAGAACGGTTATGTAGGCTAGGCTTCGATCGAGACCAGGCC
ATTCAAGCCTACTTCGCCTGCGACAAAAATGAGGAGCTCGCGGCCAACTTCCTCTTCGATCAGCCCGAAGACGAC
GAACCCTCTGCAAATTGA
Gene >Ophcf2|06519
ATGAAGATCACATTTCGGGTACAGATAGCCCCCCCCCCATATCCCGAGGCCTACACACGCTGACTCTTTTTGCAG
GATTTGAAGCAGCAAAAATTTTCTCTCGATGTCGAGCCCACGGACTTGGTACGCCCACGCCCTCCTCTTTCCTTT
TCGACGTTTGCTTACGCCTGTCAGGTCTCTACCCTCAAGGAGAAGATTTCGGCCGACAAGAGCTGGGACCCCAAA
CATGTGAAGCTCATCTACTCCGGTCAGAATACCCAGTCCCTCTTCCCGTCTAGATTCGTCTCTGACGTGATGCAG
GCAAAATCCTCAAGGATGATGAGACTGTTGAATCCTACAACATTGAAGAGAAAGGCTTCGTCGTTTGCATGGTGA
ACAAGGTATTTCCGCAGACCACCGGACAATTGTGTCCCGAAACTGACCGTCTTGGTCTCTAGCCCAAGGAAAAGC
CTCCAGTTGCCCCATCGAATCCTGCTGCCGAGTCCTCCGCCGCGCCCTCAACGGCGCCTGCTGCGTCTTCTCAGT
CCGCTTCGGCCCAGGCGACGGCGCCCGCTACCCCGACGCCTTCACGCTCCGCTGACACGCCAGCTGCAGGTGCTG
GTGATTCGTCTGGTCTCGCCATGGGCGCTCAGCGCGCCGAGGCCATCACCAATATGGAAGCCATGGGTTTTGAGA
GGTCCCAGATCGAGGCTGCGATGCGGGCCGCCTTCAACAACCCCGATCGAGCTGTCGAATACATCCTTAATGTTT
GTTCTTACAGAGCCCCCCTCCCCCTTCTGACGTCGCTGTCGGCTGACAAGATTTCAGGGAATCCCCGAAAACATT
CAGCAGGAGCAACAGCAACGCGCTGCCCCCGCCGCCGCAGCTCCTGCTCCCGCCTCCACCCAAGCAGCTCCCGAG
GCCCAAGGAAGCGACGACGACGGCGGCATCAACCTCTTCGATCTGGCTGCCCAACAGGGTGGTGGGACCGGGGCG
TCCCGAGGCGGCGGAGGCGCTTCCGCTGCTGCTGCTGCTGCCGCTGCCGCCGCTCAGGGCGGAGATCTCGGCAAT
CTGGACTTCCTGAGACATAACCCGCAGTTCCAGCAGCTCCGCCAAGTCGTCCAGCAACAGCCTCAGATGCTGGAA
CCTATCCTGCAGCAGCTCGGGGCAGGGAACCCGCACCTGGCTCAGCTCATCGCCGCCCACCCCGACCAGTTCCTT
CAGCTTCTCGGAGAGGACGTCGACGATGATGTGCCTCTGCCCCCCGGCGCGCAGGCTATCTCAGTGACGGAAGAA
GAGCGCGATGCCATAGAACGGGTATGTCTTCCGCACTCGTCGGTGAGCGAGCTCTGCTGACGTTTGTCGACATTA
GTTATGTAGGCTAGGCTTCGATCGAGACCAGGCCATTCAAGCCTACTTCGCCTGCGACAAAAATGAGGAGCTCGC
GGCCAACTTCCTCTTCGATCAGCCCGAAGACGACGAACCCTCTGCAAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail