Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06518
Gene name
Locationscaffold_08:327493..329353
Strand+
Gene length (bp)1860
Transcript length (bp)1860
Coding sequence length (bp)1860
Protein length (aa) 620

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15963 Myb_DNA-bind_7 Myb DNA-binding like 3.7E-25 440 518
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 1.8E-05 445 484

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1654 0.9554 0.0296 0.0108 0.0498 0.0273 0.0294 0.0036 0.0147 0.0072

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3670
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1315
Ophiocordyceps australis map64 (Brazil) OphauB2|5169
Ophiocordyceps camponoti-floridani Ophcf2|06518 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6658
Ophiocordyceps kimflemingae Ophio5|6605
Ophiocordyceps subramaniannii Hirsu2|7095

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06518
MSSMLKKKGGLAFKPKIPSARSRPAIAPLAPSPKSTASQSLVDPALETASVAANSSKDVIQSPVNIPSIDPPTGQ
VGAEQSSHTASEPSQSTVERPGPEPPSQSTPISRNDIPEISETVESGVVQAGGSTQHTADIDTRVDPVLDPPTTV
SSSSPPEPQSESPAERRPSETAAPETSSYTPIDEAPSVPASDPASGPSNESASGPSIESAKPASSAKKPTRKPGK
SKAKKQDDNPPKKRQRKKAANEGGTTTTTTTTTTRSRRRKRKADAQTEDGTEPKKKKGRARSVTPEDAEDQVVDL
QQLKMADLTKDLRIGKKFSRHDELRERERLARSKTKNPQQDGEPTTTGADPSSSTSPNPDGPQDASPAENASSSS
ATAATSGPQFRIVDGQIVVDQNSLVMDRHARAAAAQARGDMETVEENDFTRLITSSSFMTTSKLKGPNIWTADET
ELFYRGLRMFGTEFEMISKMFPGKQRRHVKLKFNREERHNPKRIDAALIGEKTTKMDIDEYRAFTGAVYESVEAI
EAEQRKIGERYELERQRIADEQAETMRKKREALFADDHDNANNNNNNNHNNNDANDANDANAIDGGRKKRAGNRR
KAKQTVAYGLNGEPINQSR*
Coding >Ophcf2|06518
ATGAGCTCCATGTTGAAGAAGAAGGGCGGGCTCGCCTTCAAGCCTAAGATACCTTCTGCGCGGTCGAGACCGGCA
ATCGCGCCCCTTGCTCCATCACCGAAAAGCACCGCAAGCCAGTCTTTAGTCGATCCGGCTCTCGAAACCGCCTCA
GTCGCTGCCAATAGTTCTAAAGACGTCATTCAATCTCCTGTGAATATCCCCTCGATCGATCCGCCGACGGGACAG
GTCGGCGCGGAGCAGTCTTCACATACGGCTTCCGAGCCCAGCCAAAGTACAGTTGAACGGCCAGGACCAGAACCA
CCGTCTCAGTCAACTCCAATTTCGCGCAACGATATACCCGAGATTTCAGAAACTGTCGAAAGTGGCGTGGTCCAA
GCCGGTGGTAGCACTCAACACACAGCGGATATCGACACGAGGGTCGATCCAGTCCTCGACCCTCCCACGACCGTC
TCATCGTCCTCTCCGCCTGAGCCGCAGAGCGAGTCTCCGGCAGAGAGACGGCCTAGCGAAACAGCAGCGCCCGAG
ACTTCATCATATACTCCAATCGACGAGGCGCCCTCCGTCCCCGCAAGCGACCCGGCGTCTGGACCATCCAATGAG
TCGGCGTCTGGACCATCCATTGAGTCGGCGAAGCCAGCGTCCTCAGCGAAAAAACCAACAAGGAAACCCGGGAAG
TCAAAAGCCAAGAAACAAGACGACAACCCGCCCAAAAAACGCCAACGCAAAAAGGCCGCAAATGAAGGCGGAACA
ACAACGACGACGACGACGACGACAACCCGATCCCGAAGGCGCAAACGAAAAGCCGACGCACAGACAGAAGACGGT
ACGGAACCAAAGAAGAAAAAGGGCAGGGCTCGATCCGTCACGCCCGAAGACGCAGAGGACCAGGTGGTGGACCTA
CAGCAGCTCAAGATGGCCGACTTGACCAAGGATCTACGAATCGGCAAGAAATTCAGCCGACACGACGAACTGAGA
GAAAGAGAAAGACTAGCCCGAAGCAAAACAAAGAATCCGCAACAAGACGGGGAGCCTACGACAACGGGCGCCGAT
CCCTCCAGTTCGACCTCCCCCAATCCCGACGGGCCCCAAGACGCTTCTCCCGCCGAAAACGCAAGCAGCTCATCC
GCCACAGCAGCAACATCCGGCCCCCAATTCCGCATCGTCGACGGTCAAATCGTCGTGGATCAAAACTCGCTCGTC
ATGGATCGGCACGCCCGCGCAGCAGCAGCCCAAGCAAGAGGCGACATGGAAACAGTAGAGGAAAACGACTTCACT
CGACTCATCACCAGCAGCTCCTTCATGACAACGTCGAAACTCAAAGGCCCCAACATCTGGACAGCCGACGAAACA
GAGCTCTTCTACCGCGGCCTCCGCATGTTCGGCACCGAATTCGAAATGATTTCCAAAATGTTCCCTGGCAAGCAA
AGACGACACGTCAAGCTCAAGTTCAACCGCGAAGAACGCCACAATCCGAAGCGCATCGACGCCGCCCTCATAGGC
GAGAAGACGACAAAGATGGATATTGACGAGTACCGCGCCTTCACCGGCGCCGTATACGAATCCGTCGAGGCCATC
GAGGCGGAACAGCGCAAGATTGGGGAGCGCTACGAGCTGGAGAGGCAGCGCATCGCTGACGAACAGGCTGAGACG
ATGCGCAAGAAGCGAGAGGCCCTCTTTGCCGATGACCATGACAACGCCAACAACAACAACAATAACAACCACAAC
AACAACGATGCCAACGATGCCAACGATGCCAACGCCATCGACGGGGGAAGGAAGAAACGCGCCGGCAACAGGCGC
AAGGCCAAGCAAACTGTCGCATACGGTCTCAATGGTGAGCCCATTAACCAATCTCGGTAA
Transcript >Ophcf2|06518
ATGAGCTCCATGTTGAAGAAGAAGGGCGGGCTCGCCTTCAAGCCTAAGATACCTTCTGCGCGGTCGAGACCGGCA
ATCGCGCCCCTTGCTCCATCACCGAAAAGCACCGCAAGCCAGTCTTTAGTCGATCCGGCTCTCGAAACCGCCTCA
GTCGCTGCCAATAGTTCTAAAGACGTCATTCAATCTCCTGTGAATATCCCCTCGATCGATCCGCCGACGGGACAG
GTCGGCGCGGAGCAGTCTTCACATACGGCTTCCGAGCCCAGCCAAAGTACAGTTGAACGGCCAGGACCAGAACCA
CCGTCTCAGTCAACTCCAATTTCGCGCAACGATATACCCGAGATTTCAGAAACTGTCGAAAGTGGCGTGGTCCAA
GCCGGTGGTAGCACTCAACACACAGCGGATATCGACACGAGGGTCGATCCAGTCCTCGACCCTCCCACGACCGTC
TCATCGTCCTCTCCGCCTGAGCCGCAGAGCGAGTCTCCGGCAGAGAGACGGCCTAGCGAAACAGCAGCGCCCGAG
ACTTCATCATATACTCCAATCGACGAGGCGCCCTCCGTCCCCGCAAGCGACCCGGCGTCTGGACCATCCAATGAG
TCGGCGTCTGGACCATCCATTGAGTCGGCGAAGCCAGCGTCCTCAGCGAAAAAACCAACAAGGAAACCCGGGAAG
TCAAAAGCCAAGAAACAAGACGACAACCCGCCCAAAAAACGCCAACGCAAAAAGGCCGCAAATGAAGGCGGAACA
ACAACGACGACGACGACGACGACAACCCGATCCCGAAGGCGCAAACGAAAAGCCGACGCACAGACAGAAGACGGT
ACGGAACCAAAGAAGAAAAAGGGCAGGGCTCGATCCGTCACGCCCGAAGACGCAGAGGACCAGGTGGTGGACCTA
CAGCAGCTCAAGATGGCCGACTTGACCAAGGATCTACGAATCGGCAAGAAATTCAGCCGACACGACGAACTGAGA
GAAAGAGAAAGACTAGCCCGAAGCAAAACAAAGAATCCGCAACAAGACGGGGAGCCTACGACAACGGGCGCCGAT
CCCTCCAGTTCGACCTCCCCCAATCCCGACGGGCCCCAAGACGCTTCTCCCGCCGAAAACGCAAGCAGCTCATCC
GCCACAGCAGCAACATCCGGCCCCCAATTCCGCATCGTCGACGGTCAAATCGTCGTGGATCAAAACTCGCTCGTC
ATGGATCGGCACGCCCGCGCAGCAGCAGCCCAAGCAAGAGGCGACATGGAAACAGTAGAGGAAAACGACTTCACT
CGACTCATCACCAGCAGCTCCTTCATGACAACGTCGAAACTCAAAGGCCCCAACATCTGGACAGCCGACGAAACA
GAGCTCTTCTACCGCGGCCTCCGCATGTTCGGCACCGAATTCGAAATGATTTCCAAAATGTTCCCTGGCAAGCAA
AGACGACACGTCAAGCTCAAGTTCAACCGCGAAGAACGCCACAATCCGAAGCGCATCGACGCCGCCCTCATAGGC
GAGAAGACGACAAAGATGGATATTGACGAGTACCGCGCCTTCACCGGCGCCGTATACGAATCCGTCGAGGCCATC
GAGGCGGAACAGCGCAAGATTGGGGAGCGCTACGAGCTGGAGAGGCAGCGCATCGCTGACGAACAGGCTGAGACG
ATGCGCAAGAAGCGAGAGGCCCTCTTTGCCGATGACCATGACAACGCCAACAACAACAACAATAACAACCACAAC
AACAACGATGCCAACGATGCCAACGATGCCAACGCCATCGACGGGGGAAGGAAGAAACGCGCCGGCAACAGGCGC
AAGGCCAAGCAAACTGTCGCATACGGTCTCAATGGTGAGCCCATTAACCAATCTCGGTAA
Gene >Ophcf2|06518
ATGAGCTCCATGTTGAAGAAGAAGGGCGGGCTCGCCTTCAAGCCTAAGATACCTTCTGCGCGGTCGAGACCGGCA
ATCGCGCCCCTTGCTCCATCACCGAAAAGCACCGCAAGCCAGTCTTTAGTCGATCCGGCTCTCGAAACCGCCTCA
GTCGCTGCCAATAGTTCTAAAGACGTCATTCAATCTCCTGTGAATATCCCCTCGATCGATCCGCCGACGGGACAG
GTCGGCGCGGAGCAGTCTTCACATACGGCTTCCGAGCCCAGCCAAAGTACAGTTGAACGGCCAGGACCAGAACCA
CCGTCTCAGTCAACTCCAATTTCGCGCAACGATATACCCGAGATTTCAGAAACTGTCGAAAGTGGCGTGGTCCAA
GCCGGTGGTAGCACTCAACACACAGCGGATATCGACACGAGGGTCGATCCAGTCCTCGACCCTCCCACGACCGTC
TCATCGTCCTCTCCGCCTGAGCCGCAGAGCGAGTCTCCGGCAGAGAGACGGCCTAGCGAAACAGCAGCGCCCGAG
ACTTCATCATATACTCCAATCGACGAGGCGCCCTCCGTCCCCGCAAGCGACCCGGCGTCTGGACCATCCAATGAG
TCGGCGTCTGGACCATCCATTGAGTCGGCGAAGCCAGCGTCCTCAGCGAAAAAACCAACAAGGAAACCCGGGAAG
TCAAAAGCCAAGAAACAAGACGACAACCCGCCCAAAAAACGCCAACGCAAAAAGGCCGCAAATGAAGGCGGAACA
ACAACGACGACGACGACGACGACAACCCGATCCCGAAGGCGCAAACGAAAAGCCGACGCACAGACAGAAGACGGT
ACGGAACCAAAGAAGAAAAAGGGCAGGGCTCGATCCGTCACGCCCGAAGACGCAGAGGACCAGGTGGTGGACCTA
CAGCAGCTCAAGATGGCCGACTTGACCAAGGATCTACGAATCGGCAAGAAATTCAGCCGACACGACGAACTGAGA
GAAAGAGAAAGACTAGCCCGAAGCAAAACAAAGAATCCGCAACAAGACGGGGAGCCTACGACAACGGGCGCCGAT
CCCTCCAGTTCGACCTCCCCCAATCCCGACGGGCCCCAAGACGCTTCTCCCGCCGAAAACGCAAGCAGCTCATCC
GCCACAGCAGCAACATCCGGCCCCCAATTCCGCATCGTCGACGGTCAAATCGTCGTGGATCAAAACTCGCTCGTC
ATGGATCGGCACGCCCGCGCAGCAGCAGCCCAAGCAAGAGGCGACATGGAAACAGTAGAGGAAAACGACTTCACT
CGACTCATCACCAGCAGCTCCTTCATGACAACGTCGAAACTCAAAGGCCCCAACATCTGGACAGCCGACGAAACA
GAGCTCTTCTACCGCGGCCTCCGCATGTTCGGCACCGAATTCGAAATGATTTCCAAAATGTTCCCTGGCAAGCAA
AGACGACACGTCAAGCTCAAGTTCAACCGCGAAGAACGCCACAATCCGAAGCGCATCGACGCCGCCCTCATAGGC
GAGAAGACGACAAAGATGGATATTGACGAGTACCGCGCCTTCACCGGCGCCGTATACGAATCCGTCGAGGCCATC
GAGGCGGAACAGCGCAAGATTGGGGAGCGCTACGAGCTGGAGAGGCAGCGCATCGCTGACGAACAGGCTGAGACG
ATGCGCAAGAAGCGAGAGGCCCTCTTTGCCGATGACCATGACAACGCCAACAACAACAACAATAACAACCACAAC
AACAACGATGCCAACGATGCCAACGATGCCAACGCCATCGACGGGGGAAGGAAGAAACGCGCCGGCAACAGGCGC
AAGGCCAAGCAAACTGTCGCATACGGTCTCAATGGTGAGCCCATTAACCAATCTCGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail