Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06517
Gene name
Locationscaffold_08:324391..327001
Strand-
Gene length (bp)2610
Transcript length (bp)2112
Coding sequence length (bp)2112
Protein length (aa) 704

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08647 BRE1 BRE1 E3 ubiquitin ligase 3.1E-27 456 549
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 4.8E-08 650 695
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 9.1E-08 651 689
PF14447 Prok-RING_4 Prokaryotic RING finger family 4 1.6E-07 651 696
PF13445 zf-RING_UBOX RING-type zinc-finger 6.4E-07 651 687
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 2.2E-06 651 689

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2805 0.9163 0.0579 0.0233 0.0862 0.0002 0.017 0.0191 0.0292 0.0005

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3669
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1316
Ophiocordyceps australis map64 (Brazil) OphauB2|5168
Ophiocordyceps camponoti-floridani Ophcf2|06517 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6165
Ophiocordyceps kimflemingae Ophio5|6606
Ophiocordyceps subramaniannii Hirsu2|7094

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06517
MEDRKRPGGDDLAPPSKRVAVNGSKAKDDTLDMKEESWIEAYTKGAIYRQMLEYSRKAATTESRLEELHKRCVHH
DDHLRIIDGWWRQLLEEVEVLAKGTLPDTVSPSEPPYLSGVSFKDLHEFQSHMQEKGKAIKAKAESLLCHIAAHR
GKIEPDVAAMEGKITSLLSAQKEYLLKLDRLDSEKDQLSEQLNAATLRYFRAEKKLDRAKSAQVQKLEQQAFANA
TKPAATPGDGGQDSAESNGNADDLQVKYEEAMTSATKQKEQLDAALSEFRALQDENSNLKCRQNAWTDEDLVRSD
VFKQFKGQNEDLIKRVNNLEATNKQLREEAEKLQAERTAFKGQLETDANQVTQELESEVMSRDQDLARVRSARDE
ILAENTQRKASMDQERTSLTLLRDLVEAKDDRIAALESKLARLEPTGDEEASPSADDAQELSTEDLRQKYKKLQQ
DFHAINQELPSIEKAYKKMKDLAQKKVVEVVTLEDKVALLIAEKSKADQKYFAARKDADTRNNEIRSLRHQNSKS
TEIIAQLKDVETQTRTLLGNLEKQLADLKQTNAVLTAESKKVETTSHDAVRRVETLNRQIADMSAVVKSRDAAAA
AARERYLAQEAEAEKLKVRVEHAQKDRDSWRSKALSNSSEEEEMLRTFALCTICRNNFKNTALRTCGHLFCTKCV
DDRISNRMRKCPTCSRAFDRMDVMPVHH*
Coding >Ophcf2|06517
ATGGAGGACAGGAAGAGACCCGGCGGCGACGACCTCGCGCCTCCGAGCAAGAGGGTGGCTGTCAACGGTTCCAAG
GCCAAAGACGACACGCTCGATATGAAGGAAGAGAGCTGGATTGAGGCCTATACCAAGGGAGCGATATATCGTCAG
ATGCTGGAGTATAGCCGCAAGGCAGCTACCACCGAATCGCGACTCGAAGAGCTGCATAAGCGATGCGTTCATCAT
GACGACCATTTGAGGATTATCGATGGCTGGTGGCGCCAGCTGTTGGAGGAAGTAGAAGTCCTTGCAAAGGGCACA
TTGCCTGACACCGTCAGTCCGTCAGAGCCCCCATATCTCAGCGGCGTCAGCTTCAAGGACCTCCACGAATTCCAG
AGCCACATGCAGGAAAAGGGCAAGGCGATCAAGGCCAAGGCCGAGTCTCTTCTCTGTCACATCGCCGCCCATCGC
GGAAAGATTGAACCCGACGTCGCTGCCATGGAGGGTAAAATCACCAGCTTGCTGTCCGCCCAGAAGGAATACCTC
CTCAAGCTCGATCGCTTGGACTCCGAAAAGGATCAGCTCTCGGAGCAGCTCAACGCTGCCACCCTCCGATATTTC
AGGGCCGAAAAGAAGCTTGATCGGGCCAAGAGCGCACAGGTCCAGAAGCTCGAGCAGCAAGCATTCGCGAATGCC
ACCAAGCCCGCCGCCACCCCCGGAGACGGCGGTCAGGATTCTGCCGAGTCCAATGGCAACGCCGACGACCTGCAG
GTTAAGTACGAGGAGGCAATGACGTCGGCAACGAAGCAGAAGGAGCAGCTGGACGCGGCTCTGTCGGAGTTTAGG
GCCCTGCAAGACGAAAACTCGAACCTCAAGTGTCGTCAGAATGCATGGACCGACGAAGACTTGGTACGCTCCGAC
GTCTTCAAGCAATTCAAGGGTCAAAACGAAGACCTCATCAAGCGGGTCAACAACTTGGAGGCAACCAACAAACAA
CTACGCGAAGAGGCAGAGAAGCTCCAAGCCGAGCGCACCGCTTTCAAGGGCCAACTCGAGACGGACGCGAATCAA
GTGACTCAAGAACTTGAGAGTGAAGTCATGAGCAGAGACCAGGACCTGGCTCGCGTACGATCTGCCAGGGACGAG
ATATTGGCGGAGAACACGCAGCGCAAGGCCAGCATGGACCAGGAAAGGACATCATTGACTCTTCTCAGAGACCTT
GTCGAAGCAAAGGACGACCGCATCGCTGCGCTGGAATCAAAATTGGCGCGACTCGAGCCGACGGGAGACGAGGAA
GCGTCACCATCGGCGGACGACGCCCAGGAGCTTTCGACGGAGGACCTCCGACAAAAGTACAAAAAGCTGCAGCAA
GACTTTCACGCCATCAACCAGGAATTGCCGTCGATCGAGAAGGCGTATAAGAAGATGAAGGACCTGGCGCAGAAG
AAGGTCGTGGAAGTTGTGACGCTCGAGGACAAGGTTGCCCTCTTGATTGCCGAGAAGAGCAAGGCAGACCAGAAG
TACTTTGCTGCGCGGAAAGATGCCGACACTCGAAACAACGAGATCCGGTCGCTTAGGCATCAGAACAGCAAAAGC
ACGGAGATTATCGCTCAGCTCAAGGATGTCGAGACGCAGACTAGGACTCTGCTGGGCAACCTTGAGAAGCAGCTC
GCGGATCTCAAGCAGACCAACGCCGTACTGACGGCTGAGAGCAAGAAGGTGGAGACGACGAGCCACGATGCCGTG
AGACGAGTCGAAACTCTGAATCGACAGATCGCGGACATGTCAGCCGTGGTCAAGTCCCGGGACGCGGCGGCGGCG
GCAGCCCGGGAGCGCTACTTGGCCCAGGAGGCTGAGGCGGAGAAGCTCAAGGTGCGGGTCGAGCACGCGCAGAAG
GACCGGGACAGCTGGCGCAGTAAGGCGTTGAGCAATTCGTCTGAAGAGGAAGAGATGTTGCGGACGTTTGCTCTG
TGTACGATTTGCCGCAACAACTTTAAGAACACGGCGTTGAGGACCTGCGGCCACCTTTTTTGCACCAAGTGCGTC
GACGATCGCATCAGCAATCGCATGCGCAAGTGCCCTACTTGCTCTCGCGCGTTCGACCGGATGGACGTCATGCCG
GTTCATCACTGA
Transcript >Ophcf2|06517
ATGGAGGACAGGAAGAGACCCGGCGGCGACGACCTCGCGCCTCCGAGCAAGAGGGTGGCTGTCAACGGTTCCAAG
GCCAAAGACGACACGCTCGATATGAAGGAAGAGAGCTGGATTGAGGCCTATACCAAGGGAGCGATATATCGTCAG
ATGCTGGAGTATAGCCGCAAGGCAGCTACCACCGAATCGCGACTCGAAGAGCTGCATAAGCGATGCGTTCATCAT
GACGACCATTTGAGGATTATCGATGGCTGGTGGCGCCAGCTGTTGGAGGAAGTAGAAGTCCTTGCAAAGGGCACA
TTGCCTGACACCGTCAGTCCGTCAGAGCCCCCATATCTCAGCGGCGTCAGCTTCAAGGACCTCCACGAATTCCAG
AGCCACATGCAGGAAAAGGGCAAGGCGATCAAGGCCAAGGCCGAGTCTCTTCTCTGTCACATCGCCGCCCATCGC
GGAAAGATTGAACCCGACGTCGCTGCCATGGAGGGTAAAATCACCAGCTTGCTGTCCGCCCAGAAGGAATACCTC
CTCAAGCTCGATCGCTTGGACTCCGAAAAGGATCAGCTCTCGGAGCAGCTCAACGCTGCCACCCTCCGATATTTC
AGGGCCGAAAAGAAGCTTGATCGGGCCAAGAGCGCACAGGTCCAGAAGCTCGAGCAGCAAGCATTCGCGAATGCC
ACCAAGCCCGCCGCCACCCCCGGAGACGGCGGTCAGGATTCTGCCGAGTCCAATGGCAACGCCGACGACCTGCAG
GTTAAGTACGAGGAGGCAATGACGTCGGCAACGAAGCAGAAGGAGCAGCTGGACGCGGCTCTGTCGGAGTTTAGG
GCCCTGCAAGACGAAAACTCGAACCTCAAGTGTCGTCAGAATGCATGGACCGACGAAGACTTGGTACGCTCCGAC
GTCTTCAAGCAATTCAAGGGTCAAAACGAAGACCTCATCAAGCGGGTCAACAACTTGGAGGCAACCAACAAACAA
CTACGCGAAGAGGCAGAGAAGCTCCAAGCCGAGCGCACCGCTTTCAAGGGCCAACTCGAGACGGACGCGAATCAA
GTGACTCAAGAACTTGAGAGTGAAGTCATGAGCAGAGACCAGGACCTGGCTCGCGTACGATCTGCCAGGGACGAG
ATATTGGCGGAGAACACGCAGCGCAAGGCCAGCATGGACCAGGAAAGGACATCATTGACTCTTCTCAGAGACCTT
GTCGAAGCAAAGGACGACCGCATCGCTGCGCTGGAATCAAAATTGGCGCGACTCGAGCCGACGGGAGACGAGGAA
GCGTCACCATCGGCGGACGACGCCCAGGAGCTTTCGACGGAGGACCTCCGACAAAAGTACAAAAAGCTGCAGCAA
GACTTTCACGCCATCAACCAGGAATTGCCGTCGATCGAGAAGGCGTATAAGAAGATGAAGGACCTGGCGCAGAAG
AAGGTCGTGGAAGTTGTGACGCTCGAGGACAAGGTTGCCCTCTTGATTGCCGAGAAGAGCAAGGCAGACCAGAAG
TACTTTGCTGCGCGGAAAGATGCCGACACTCGAAACAACGAGATCCGGTCGCTTAGGCATCAGAACAGCAAAAGC
ACGGAGATTATCGCTCAGCTCAAGGATGTCGAGACGCAGACTAGGACTCTGCTGGGCAACCTTGAGAAGCAGCTC
GCGGATCTCAAGCAGACCAACGCCGTACTGACGGCTGAGAGCAAGAAGGTGGAGACGACGAGCCACGATGCCGTG
AGACGAGTCGAAACTCTGAATCGACAGATCGCGGACATGTCAGCCGTGGTCAAGTCCCGGGACGCGGCGGCGGCG
GCAGCCCGGGAGCGCTACTTGGCCCAGGAGGCTGAGGCGGAGAAGCTCAAGGTGCGGGTCGAGCACGCGCAGAAG
GACCGGGACAGCTGGCGCAGTAAGGCGTTGAGCAATTCGTCTGAAGAGGAAGAGATGTTGCGGACGTTTGCTCTG
TGTACGATTTGCCGCAACAACTTTAAGAACACGGCGTTGAGGACCTGCGGCCACCTTTTTTGCACCAAGTGCGTC
GACGATCGCATCAGCAATCGCATGCGCAAGTGCCCTACTTGCTCTCGCGCGTTCGACCGGATGGACGTCATGCCG
GTTCATCACTGA
Gene >Ophcf2|06517
ATGGAGGACAGGAAGAGACCCGGCGGCGACGACCTCGCGCCTCCGAGCAAGAGGGTGGCTGTCAACGGTTCCAAG
GCCAAAGACGACACGCTCGATATGAAGGAAGAGAGCTGGATTGAGGTACGTGCCCTTTGGGTCGATTCTCGCCCC
CCCCCCCCCCCCCCCCCCCCTCACCCCTCCACCATCCCCCCTCCAGAAGTCCCCCCTCCCCGCTCCATGTCCTCT
CATTTGCCGGGCCTTAGGACACGACAATCCTCTTCGTGTTCATGGCTTCCCTTGCGCGACCAGTGAAGCTCACCA
AGCCAGTGATGATGCTCGTTGCCTAGCGACGGTAATCAGCTGCTCCCCGAATGCACATCACACACTCCCTTTCCC
ACGCTTCAGACTGCACCTCGCACCCCTTCATCCTCTTATCGACCGACTACGGTACTAACTGGGACCAATCAGGCC
TATACCAAGGGAGCGATATATCGTCAGATGCTGGAGTATAGCCGCAAGGCAGCTACCACCGAATCGCGACTCGAA
GAGCTGCATAAGCGATGCGTTCATCATGACGACCATTTGAGGATTATCGATGGCTGGTGGCGCCAGGTCCGTCCT
TGTCCGTCCATGTCCCAACGCCCGGCTGATTTGGCTGCAATAGCTGTTGGAGGAAGTAGAAGTCCTTGCAAAGGG
CACATTGCCTGACACCGTCAGTCCGTCAGGTGCGTTGACACCGGTTTATCTACTCGTCGAGGTATTTTCTAACCG
AATTGACCGGCCAGAGCCCCCATATCTCAGCGGCGTCAGCTTCAAGGACCTCCACGAATTCCAGAGCCACATGCA
GGAAAAGGGCAAGGCGATCAAGGCCAAGGCCGAGTCTCTTCTCTGTCACATCGCCGCCCATCGCGGAAAGATTGA
ACCCGACGTCGCTGCCATGGAGGGTAAAATCACCAGCTTGCTGTCCGCCCAGAAGGAATACCTCCTCAAGCTCGA
TCGCTTGGACTCCGAAAAGGATCAGCTCTCGGAGCAGCTCAACGCTGCCACCCTCCGATATTTCAGGGCCGAAAA
GAAGCTTGATCGGGCCAAGAGCGCACAGGTCCAGAAGCTCGAGCAGCAAGCATTCGCGAATGCCACCAAGCCCGC
CGCCACCCCCGGAGACGGCGGTCAGGATTCTGCCGAGTCCAATGGCAACGCCGACGACCTGCAGGTTAAGTACGA
GGAGGCAATGACGTCGGCAACGAAGCAGAAGGAGCAGCTGGACGCGGCTCTGTCGGAGTTTAGGGCCCTGCAAGA
CGAAAACTCGAACCTCAAGTGTCGTCAGAATGCATGGACCGACGAAGACTTGGTACGCTCCGACGTCTTCAAGCA
ATTCAAGGGTCAAAACGAAGACCTCATCAAGCGGGTCAACAACTTGGAGGCAACCAACAAACAACTACGCGAAGA
GGCAGAGAAGCTCCAAGCCGAGCGCACCGCTTTCAAGGGCCAACTCGAGACGGACGCGAATCAAGTGACTCAAGA
ACTTGAGAGTGAAGTCATGAGCAGAGACCAGGACCTGGCTCGCGTACGATCTGCCAGGGACGAGATATTGGCGGA
GAACACGCAGCGCAAGGCCAGCATGGACCAGGAAAGGACATCATTGACTCTTCTCAGAGACCTTGTCGAAGCAAA
GGACGACCGCATCGCTGCGCTGGAATCAAAATTGGCGCGACTCGAGCCGACGGGAGACGAGGAAGCGTCACCATC
GGCGGACGACGCCCAGGAGCTTTCGACGGAGGACCTCCGACAAAAGTACAAAAAGCTGCAGCAAGACTTTCACGC
CATCAACCAGGAATTGCCGTCGATCGAGAAGGCGTATAAGAAGATGAAGGACCTGGCGCAGAAGAAGGTCGTGGA
AGTTGTGACGCTCGAGGACAAGGTTGCCCTCTTGATTGCCGAGAAGAGCAAGGCAGACCAGAAGTACTTTGCTGC
GCGGAAAGATGCCGACACTCGAAACAACGAGATCCGGTCGCTTAGGCATCAGAACAGCAAAAGCACGGAGATTAT
CGCTCAGCTCAAGGATGTCGAGACGCAGACTAGGACTCTGCTGGGCAACCTTGAGAAGCAGCTCGCGGATCTCAA
GCAGACCAACGCCGTACTGACGGCTGAGAGCAAGAAGGTGGAGACGACGAGCCACGATGCCGTGAGACGAGTCGA
AACTCTGAATCGACAGATCGCGGACATGTCAGCCGTGGTCAAGTCCCGGGACGCGGCGGCGGCGGCAGCCCGGGA
GCGCTACTTGGCCCAGGAGGCTGAGGCGGAGAAGCTCAAGGTGCGGGTCGAGCACGCGCAGAAGGACCGGGACAG
CTGGCGCAGTAAGGCGTTGAGCAATTCGTCTGAAGAGGAAGAGATGTTGCGGGTGAGTCGAAACACCCCTCCACC
TGCTCGAGTCTTGGGGATCGCTGACGCCGGCTTCAGACGTTTGCTCTGTGTACGATTTGCCGCAACAACTTTAAG
AACACGGCGTTGAGGACCTGCGGCCACCTTTTTTGCACCAAGTGCGTCGACGATCGCATCAGCAATCGCATGCGC
AAGTGCCCTACTTGCTCTCGCGCGTTCGACCGGATGGACGTCATGCCGGTTCATCACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail