Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06513
Gene name
Locationscaffold_08:307297..309298
Strand-
Gene length (bp)2001
Transcript length (bp)2001
Coding sequence length (bp)2001
Protein length (aa) 667

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09362 DUF1996 Domain of unknown function (DUF1996) 1.5E-61 38 300
PF01822 WSC WSC domain 1.0E-17 554 633

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1013 0.1466 0.9543 0.185 0.0591 0.0106 0.1004 0.1285 0.0469 0.0022

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.992025

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2558
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2354
Ophiocordyceps australis map64 (Brazil) OphauB2|5163
Ophiocordyceps camponoti-floridani Ophcf2|06513 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5610
Ophiocordyceps kimflemingae Ophio5|6612
Ophiocordyceps subramaniannii Hirsu2|3803

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06513
MKPLILTTALAALATAKDHRSFAVLRFTNKQLTKGRMDPIRSPGKTGAHVHHVLGGSGFGTSSTGKDLLESNCST
AKVKGDNSNYWFPSLYFRDAGTGKLEGVDLFYANAYYFFEATNDDIKAFPTGLSIVSGDVDATSAPVGGSVSNLD
ASKGPINAVKWTCPRRDNLYNPPSWPAGSDGSMAGIGDAVNKGEGVGFPHVDCDGFASPLRADIHFPSCYDPAVG
LTDYKRNMVFPSDAGDGKMDCPKGHIHVPHLFLEVYWDTPAFKDRWEQGKGKQPFVLSNGDATGFSLHADFMAGW
DEKVLQHVIDTCDAGTAGMDKCPGLPLGLNEADCTVEPAVKEKVDGVLDALPGDNGMKGWSYGGTRLVSGTDAPA
ASSGYSSGFGSESRTTSSGLVSGTEAPVTPSGPSSGFNSESPATSSGTPSASASEYPPPANSEPSPSRKPTRYQL
PVKELVSASTSPSSSAVGYHVPSRAASSRHYTNSTMAGPTASHPIGSAITIPATSEACITKTVTVRQTVTVTNRA
PPSAVTSRAPPSAVTNRPSTNSTVNGYRYTGCFRDSPSRILNGVIRADVGAVSNANCVDHCRAAGYGLAGTEYGG
QCYCGSRLLTSDRLDDGRCDMACEGDAADICGGSWALSVYGRGNATEAKMQRHLYDHVRRRRSLYR*
Coding >Ophcf2|06513
ATGAAGCCCCTCATCCTCACCACCGCCCTCGCCGCCCTCGCCACGGCAAAGGATCACCGCTCCTTCGCCGTCCTC
CGCTTCACGAACAAGCAGCTCACAAAAGGACGAATGGATCCCATCCGCTCGCCCGGCAAGACTGGCGCTCACGTT
CACCACGTTCTTGGCGGCAGCGGCTTCGGCACGTCGTCTACGGGGAAGGACCTGCTGGAATCCAATTGCAGCACT
GCCAAGGTCAAGGGCGATAACAGCAATTACTGGTTTCCTTCCTTGTATTTTCGAGATGCTGGCACGGGGAAGCTC
GAGGGCGTGGATTTGTTCTACGCCAATGCTTATTACTTCTTCGAGGCGACCAATGATGATATCAAGGCTTTTCCT
ACGGGGCTCAGCATCGTTAGTGGTGATGTTGACGCGACGTCTGCGCCTGTCGGGGGCAGTGTTAGCAATCTGGAT
GCGTCAAAGGGGCCCATCAACGCGGTGAAATGGACGTGTCCTCGTCGGGACAACCTCTACAACCCTCCTTCTTGG
CCAGCTGGTTCGGACGGAAGCATGGCTGGTATCGGAGATGCGGTCAACAAGGGCGAGGGCGTTGGCTTCCCGCAT
GTCGACTGCGATGGCTTTGCTTCGCCGCTTCGGGCCGACATTCACTTCCCGTCTTGTTACGATCCTGCTGTTGGC
TTGACGGATTACAAGCGCAACATGGTCTTCCCAAGCGATGCGGGAGACGGCAAGATGGACTGTCCAAAGGGACAC
ATACACGTACCTCATCTCTTCCTCGAGGTCTACTGGGACACGCCTGCTTTCAAGGACCGGTGGGAGCAGGGCAAG
GGCAAGCAGCCGTTCGTCTTGTCCAACGGGGACGCCACGGGCTTCAGCCTGCACGCCGACTTTATGGCCGGGTGG
GATGAGAAGGTGTTGCAGCATGTGATTGATACCTGTGATGCTGGCACGGCGGGGATGGATAAGTGTCCTGGGTTG
CCGTTGGGGTTGAATGAGGCGGATTGTACGGTTGAGCCGGCTGTTAAGGAGAAGGTGGATGGGGTGCTTGATGCG
TTGCCGGGGGATAACGGGATGAAGGGCTGGTCTTATGGGGGGACTCGGCTGGTTTCTGGCACGGACGCTCCGGCG
GCTTCTTCCGGGTACAGCTCCGGCTTCGGATCCGAGTCTCGGACGACTTCTTCGGGCTTGGTTTCTGGGACGGAG
GCTCCGGTGACTCCGTCCGGTCCCAGCTCCGGCTTCAACTCCGAGTCTCCGGCCACTTCTTCCGGCACCCCCTCC
GCCTCCGCCTCCGAATACCCACCGCCCGCCAACTCCGAACCCTCTCCCTCCCGGAAGCCGACCCGATACCAGTTG
CCGGTCAAGGAACTGGTCAGCGCCTCCACGTCGCCCTCCTCCTCCGCCGTCGGCTACCACGTGCCGTCTCGAGCA
GCATCGTCCCGTCACTACACCAACTCGACAATGGCCGGACCGACCGCCTCTCACCCGATCGGATCCGCCATCACG
ATACCGGCCACATCCGAAGCCTGCATCACCAAGACGGTCACGGTCAGACAGACGGTGACCGTCACCAACAGAGCG
CCCCCTTCAGCCGTCACCAGCAGAGCGCCCCCTTCAGCCGTCACCAACCGACCGTCCACCAACTCGACCGTCAAC
GGCTACCGATACACAGGCTGCTTCAGAGACTCGCCCTCTCGCATCCTCAACGGCGTCATCCGCGCAGACGTCGGA
GCCGTCAGCAACGCAAACTGCGTCGACCACTGCCGGGCCGCGGGCTACGGCCTGGCCGGAACCGAGTACGGCGGA
CAGTGCTACTGCGGAAGCCGGCTCCTGACCTCGGACCGGCTCGATGACGGCCGCTGCGACATGGCTTGCGAGGGA
GACGCCGCTGACATCTGTGGCGGTAGCTGGGCGCTGTCTGTCTATGGCAGGGGGAATGCCACCGAGGCCAAGATG
CAGCGCCATCTGTACGACCATGTCAGGAGGCGTCGCAGCCTGTATCGTTAG
Transcript >Ophcf2|06513
ATGAAGCCCCTCATCCTCACCACCGCCCTCGCCGCCCTCGCCACGGCAAAGGATCACCGCTCCTTCGCCGTCCTC
CGCTTCACGAACAAGCAGCTCACAAAAGGACGAATGGATCCCATCCGCTCGCCCGGCAAGACTGGCGCTCACGTT
CACCACGTTCTTGGCGGCAGCGGCTTCGGCACGTCGTCTACGGGGAAGGACCTGCTGGAATCCAATTGCAGCACT
GCCAAGGTCAAGGGCGATAACAGCAATTACTGGTTTCCTTCCTTGTATTTTCGAGATGCTGGCACGGGGAAGCTC
GAGGGCGTGGATTTGTTCTACGCCAATGCTTATTACTTCTTCGAGGCGACCAATGATGATATCAAGGCTTTTCCT
ACGGGGCTCAGCATCGTTAGTGGTGATGTTGACGCGACGTCTGCGCCTGTCGGGGGCAGTGTTAGCAATCTGGAT
GCGTCAAAGGGGCCCATCAACGCGGTGAAATGGACGTGTCCTCGTCGGGACAACCTCTACAACCCTCCTTCTTGG
CCAGCTGGTTCGGACGGAAGCATGGCTGGTATCGGAGATGCGGTCAACAAGGGCGAGGGCGTTGGCTTCCCGCAT
GTCGACTGCGATGGCTTTGCTTCGCCGCTTCGGGCCGACATTCACTTCCCGTCTTGTTACGATCCTGCTGTTGGC
TTGACGGATTACAAGCGCAACATGGTCTTCCCAAGCGATGCGGGAGACGGCAAGATGGACTGTCCAAAGGGACAC
ATACACGTACCTCATCTCTTCCTCGAGGTCTACTGGGACACGCCTGCTTTCAAGGACCGGTGGGAGCAGGGCAAG
GGCAAGCAGCCGTTCGTCTTGTCCAACGGGGACGCCACGGGCTTCAGCCTGCACGCCGACTTTATGGCCGGGTGG
GATGAGAAGGTGTTGCAGCATGTGATTGATACCTGTGATGCTGGCACGGCGGGGATGGATAAGTGTCCTGGGTTG
CCGTTGGGGTTGAATGAGGCGGATTGTACGGTTGAGCCGGCTGTTAAGGAGAAGGTGGATGGGGTGCTTGATGCG
TTGCCGGGGGATAACGGGATGAAGGGCTGGTCTTATGGGGGGACTCGGCTGGTTTCTGGCACGGACGCTCCGGCG
GCTTCTTCCGGGTACAGCTCCGGCTTCGGATCCGAGTCTCGGACGACTTCTTCGGGCTTGGTTTCTGGGACGGAG
GCTCCGGTGACTCCGTCCGGTCCCAGCTCCGGCTTCAACTCCGAGTCTCCGGCCACTTCTTCCGGCACCCCCTCC
GCCTCCGCCTCCGAATACCCACCGCCCGCCAACTCCGAACCCTCTCCCTCCCGGAAGCCGACCCGATACCAGTTG
CCGGTCAAGGAACTGGTCAGCGCCTCCACGTCGCCCTCCTCCTCCGCCGTCGGCTACCACGTGCCGTCTCGAGCA
GCATCGTCCCGTCACTACACCAACTCGACAATGGCCGGACCGACCGCCTCTCACCCGATCGGATCCGCCATCACG
ATACCGGCCACATCCGAAGCCTGCATCACCAAGACGGTCACGGTCAGACAGACGGTGACCGTCACCAACAGAGCG
CCCCCTTCAGCCGTCACCAGCAGAGCGCCCCCTTCAGCCGTCACCAACCGACCGTCCACCAACTCGACCGTCAAC
GGCTACCGATACACAGGCTGCTTCAGAGACTCGCCCTCTCGCATCCTCAACGGCGTCATCCGCGCAGACGTCGGA
GCCGTCAGCAACGCAAACTGCGTCGACCACTGCCGGGCCGCGGGCTACGGCCTGGCCGGAACCGAGTACGGCGGA
CAGTGCTACTGCGGAAGCCGGCTCCTGACCTCGGACCGGCTCGATGACGGCCGCTGCGACATGGCTTGCGAGGGA
GACGCCGCTGACATCTGTGGCGGTAGCTGGGCGCTGTCTGTCTATGGCAGGGGGAATGCCACCGAGGCCAAGATG
CAGCGCCATCTGTACGACCATGTCAGGAGGCGTCGCAGCCTGTATCGTTAG
Gene >Ophcf2|06513
ATGAAGCCCCTCATCCTCACCACCGCCCTCGCCGCCCTCGCCACGGCAAAGGATCACCGCTCCTTCGCCGTCCTC
CGCTTCACGAACAAGCAGCTCACAAAAGGACGAATGGATCCCATCCGCTCGCCCGGCAAGACTGGCGCTCACGTT
CACCACGTTCTTGGCGGCAGCGGCTTCGGCACGTCGTCTACGGGGAAGGACCTGCTGGAATCCAATTGCAGCACT
GCCAAGGTCAAGGGCGATAACAGCAATTACTGGTTTCCTTCCTTGTATTTTCGAGATGCTGGCACGGGGAAGCTC
GAGGGCGTGGATTTGTTCTACGCCAATGCTTATTACTTCTTCGAGGCGACCAATGATGATATCAAGGCTTTTCCT
ACGGGGCTCAGCATCGTTAGTGGTGATGTTGACGCGACGTCTGCGCCTGTCGGGGGCAGTGTTAGCAATCTGGAT
GCGTCAAAGGGGCCCATCAACGCGGTGAAATGGACGTGTCCTCGTCGGGACAACCTCTACAACCCTCCTTCTTGG
CCAGCTGGTTCGGACGGAAGCATGGCTGGTATCGGAGATGCGGTCAACAAGGGCGAGGGCGTTGGCTTCCCGCAT
GTCGACTGCGATGGCTTTGCTTCGCCGCTTCGGGCCGACATTCACTTCCCGTCTTGTTACGATCCTGCTGTTGGC
TTGACGGATTACAAGCGCAACATGGTCTTCCCAAGCGATGCGGGAGACGGCAAGATGGACTGTCCAAAGGGACAC
ATACACGTACCTCATCTCTTCCTCGAGGTCTACTGGGACACGCCTGCTTTCAAGGACCGGTGGGAGCAGGGCAAG
GGCAAGCAGCCGTTCGTCTTGTCCAACGGGGACGCCACGGGCTTCAGCCTGCACGCCGACTTTATGGCCGGGTGG
GATGAGAAGGTGTTGCAGCATGTGATTGATACCTGTGATGCTGGCACGGCGGGGATGGATAAGTGTCCTGGGTTG
CCGTTGGGGTTGAATGAGGCGGATTGTACGGTTGAGCCGGCTGTTAAGGAGAAGGTGGATGGGGTGCTTGATGCG
TTGCCGGGGGATAACGGGATGAAGGGCTGGTCTTATGGGGGGACTCGGCTGGTTTCTGGCACGGACGCTCCGGCG
GCTTCTTCCGGGTACAGCTCCGGCTTCGGATCCGAGTCTCGGACGACTTCTTCGGGCTTGGTTTCTGGGACGGAG
GCTCCGGTGACTCCGTCCGGTCCCAGCTCCGGCTTCAACTCCGAGTCTCCGGCCACTTCTTCCGGCACCCCCTCC
GCCTCCGCCTCCGAATACCCACCGCCCGCCAACTCCGAACCCTCTCCCTCCCGGAAGCCGACCCGATACCAGTTG
CCGGTCAAGGAACTGGTCAGCGCCTCCACGTCGCCCTCCTCCTCCGCCGTCGGCTACCACGTGCCGTCTCGAGCA
GCATCGTCCCGTCACTACACCAACTCGACAATGGCCGGACCGACCGCCTCTCACCCGATCGGATCCGCCATCACG
ATACCGGCCACATCCGAAGCCTGCATCACCAAGACGGTCACGGTCAGACAGACGGTGACCGTCACCAACAGAGCG
CCCCCTTCAGCCGTCACCAGCAGAGCGCCCCCTTCAGCCGTCACCAACCGACCGTCCACCAACTCGACCGTCAAC
GGCTACCGATACACAGGCTGCTTCAGAGACTCGCCCTCTCGCATCCTCAACGGCGTCATCCGCGCAGACGTCGGA
GCCGTCAGCAACGCAAACTGCGTCGACCACTGCCGGGCCGCGGGCTACGGCCTGGCCGGAACCGAGTACGGCGGA
CAGTGCTACTGCGGAAGCCGGCTCCTGACCTCGGACCGGCTCGATGACGGCCGCTGCGACATGGCTTGCGAGGGA
GACGCCGCTGACATCTGTGGCGGTAGCTGGGCGCTGTCTGTCTATGGCAGGGGGAATGCCACCGAGGCCAAGATG
CAGCGCCATCTGTACGACCATGTCAGGAGGCGTCGCAGCCTGTATCGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail