Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06506
Gene name
Locationscaffold_08:290354..292761
Strand-
Gene length (bp)2407
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase 3.4E-70 13 233

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 293 315 22
2 356 378 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 70.14 40.01 100.26
Alive In ants, during behavior modification 43.88 23.60 64.16
Dead In ants, recently dead 35.22 18.61 51.82

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.012565 yes
Alive Dead 0.232897 no
Dead Fungus 0.000657 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06506
MAKSQPNLYAFPDVDALAPALRAYVLQCQSAAFDRHGTFKVAVSGGSLPKTLAAALLDCPSIDWSRWEIFFADER
AVPLDDPESNYALVKKDMLDRLPKDTAQPVVHPINVDLLDEGVQAVADAYERTLVGSFASRDSVRLPIFDLVLLG
CGPDGHTCSLFPGHALLRETDAWVAPIQDSPKPPPRRITLTLPVVTHAIRAAFVATGASKRDVMKKIFDSPDEQL
PCNLVNAAAGDRCSCISLVQGHLAAFQLGARARNRGEALAELLARAGVPLRFSGQGVAVEEVQFVEKAGLVVIFV
VVVVVVVAFFFSSCGADRPAVTVLLARACIAPRLTPTPDPGTASVRLDVDAERPSVIALRPFVVVVVVGGGGGGI
MAADPGLAAPPRGVGVAVVDRALPPGFTGSRLGEIDSPGLGPVRWDRLR*
Coding >Ophcf2|06506
ATGGCCAAGTCACAGCCCAACCTCTACGCCTTCCCCGACGTCGACGCCCTCGCTCCCGCCCTCCGCGCCTACGTC
CTTCAATGTCAATCCGCCGCCTTCGACCGCCACGGCACCTTCAAGGTAGCCGTCTCAGGCGGATCGCTGCCCAAG
ACTCTGGCAGCCGCCCTGCTCGACTGCCCGTCCATCGACTGGTCACGGTGGGAAATCTTCTTCGCCGATGAGCGC
GCCGTTCCCCTCGACGACCCCGAATCCAACTACGCGCTCGTCAAGAAGGACATGTTGGATCGTCTGCCCAAGGAT
ACGGCCCAGCCGGTCGTGCACCCCATCAACGTCGACCTCCTCGACGAAGGCGTCCAGGCCGTGGCGGACGCGTAC
GAGAGGACGTTAGTGGGTAGCTTCGCAAGCCGCGACTCCGTCCGCCTCCCCATCTTCGACCTCGTCCTCCTCGGA
TGCGGACCCGACGGACACACCTGCTCCCTCTTCCCCGGCCACGCCCTTCTCCGCGAGACAGACGCCTGGGTGGCG
CCCATCCAAGACTCGCCCAAGCCTCCACCCCGACGGATCACGCTGACGCTTCCCGTCGTGACGCACGCCATCCGT
GCCGCCTTTGTCGCTACCGGTGCCTCTAAGCGCGACGTCATGAAGAAGATCTTCGATTCGCCCGACGAGCAACTC
CCCTGCAATCTCGTCAATGCCGCGGCTGGTGATCGCTGCAGCTGCATCAGCCTCGTCCAAGGCCATCTCGCGGCT
TTCCAGCTCGGCGCCCGCGCGCGAAACAGAGGCGAAGCGCTGGCCGAGCTTCTCGCGCGCGCTGGCGTGCCACTG
CGCTTCAGCGGTCAGGGCGTCGCGGTGGAGGAGGTGCAGTTCGTAGAGAAGGCCGGTCTCGTCGTCATCTTCGTC
GTCGTCGTCGTCGTCGTCGTAGCCTTCTTCTTCTCTTCTTGCGGAGCAGATAGACCAGCCGTGACGGTACTCCTG
GCACGCGCATGCATCGCACCACGTCTAACCCCGACGCCCGACCCGGGAACAGCATCCGTCCGACTCGACGTCGAC
GCCGAACGCCCCAGCGTCATCGCGCTCCGACCCTTCGTCGTCGTCGTCGTCGTCGGTGGAGGAGGAGGCGGCATC
ATGGCAGCGGATCCCGGTCTCGCCGCACCACCGCGCGGAGTCGGAGTCGCCGTCGTGGACCGCGCGCTCCCTCCC
GGCTTCACCGGCAGCCGGCTGGGCGAGATCGACTCTCCCGGCCTCGGACCCGTGCGCTGGGATCGACTGCGCTGA
Transcript >Ophcf2|06506
ATGGCCAAGTCACAGCCCAACCTCTACGCCTTCCCCGACGTCGACGCCCTCGCTCCCGCCCTCCGCGCCTACGTC
CTTCAATGTCAATCCGCCGCCTTCGACCGCCACGGCACCTTCAAGGTAGCCGTCTCAGGCGGATCGCTGCCCAAG
ACTCTGGCAGCCGCCCTGCTCGACTGCCCGTCCATCGACTGGTCACGGTGGGAAATCTTCTTCGCCGATGAGCGC
GCCGTTCCCCTCGACGACCCCGAATCCAACTACGCGCTCGTCAAGAAGGACATGTTGGATCGTCTGCCCAAGGAT
ACGGCCCAGCCGGTCGTGCACCCCATCAACGTCGACCTCCTCGACGAAGGCGTCCAGGCCGTGGCGGACGCGTAC
GAGAGGACGTTAGTGGGTAGCTTCGCAAGCCGCGACTCCGTCCGCCTCCCCATCTTCGACCTCGTCCTCCTCGGA
TGCGGACCCGACGGACACACCTGCTCCCTCTTCCCCGGCCACGCCCTTCTCCGCGAGACAGACGCCTGGGTGGCG
CCCATCCAAGACTCGCCCAAGCCTCCACCCCGACGGATCACGCTGACGCTTCCCGTCGTGACGCACGCCATCCGT
GCCGCCTTTGTCGCTACCGGTGCCTCTAAGCGCGACGTCATGAAGAAGATCTTCGATTCGCCCGACGAGCAACTC
CCCTGCAATCTCGTCAATGCCGCGGCTGGTGATCGCTGCAGCTGCATCAGCCTCGTCCAAGGCCATCTCGCGGCT
TTCCAGCTCGGCGCCCGCGCGCGAAACAGAGGCGAAGCGCTGGCCGAGCTTCTCGCGCGCGCTGGCGTGCCACTG
CGCTTCAGCGGTCAGGGCGTCGCGGTGGAGGAGGTGCAGTTCGTAGAGAAGGCCGGTCTCGTCGTCATCTTCGTC
GTCGTCGTCGTCGTCGTCGTAGCCTTCTTCTTCTCTTCTTGCGGAGCAGATAGACCAGCCGTGACGGTACTCCTG
GCACGCGCATGCATCGCACCACGTCTAACCCCGACGCCCGACCCGGGAACAGCATCCGTCCGACTCGACGTCGAC
GCCGAACGCCCCAGCGTCATCGCGCTCCGACCCTTCGTCGTCGTCGTCGTCGTCGGTGGAGGAGGAGGCGGCATC
ATGGCAGCGGATCCCGGTCTCGCCGCACCACCGCGCGGAGTCGGAGTCGCCGTCGTGGACCGCGCGCTCCCTCCC
GGCTTCACCGGCAGCCGGCTGGGCGAGATCGACTCTCCCGGCCTCGGACCCGTGCGCTGGGATCGACTGCGCTGA
Gene >Ophcf2|06506
ATGGCCAAGTCACAGCCCAACCTCTACGCCTTCCCCGACGTCGACGCCCTCGCTCCCGCCCTCCGCGCCTACGTC
CTTCAATGTCAATCCGCCGCCTTCGACCGCCACGGCACCTTCAAGGTAGCCGTCTCAGGCGGATCGCTGCCCAAG
ACTCTGGCAGCCGCCCTGCTCGACTGCCCGTCCATCGACTGGTCACGGTGGGAAATCTTCTTCGCCGATGAGCGC
GCCGTTCCCCTCGACGACCCCGAATCCAACTACGCGCTCGTCAAGAAGGACATGTTGGATCGTCTGCCCAAGGAT
ACGGCCCAGCCGGTCGTGCACCCCATCAACGTCGACCTCCTCGACGAAGGCGTCCAGGCCGTGGCGGACGCGTAC
GAGAGGACGTTAGTGGGTAGCTTCGCAAGCCGCGACTCCGTCCGCCTCCCCATCTTCGACCTCGTCCTCCTCGGA
TGCGGACCCGACGGACACACCTGCTCCCTCTTCCCCGGCCACGCCCTTCTCCGCGAGACAGACGCCTGGGTGGCG
CCCATCCAAGACTCGCCCAAGCCTCCACCCCGACGGATCACGCTGACGCTTCCCGTCGTGACGCACGCCATCCGT
GCCGCCTTTGTCGCTACCGGTGCCTCTAAGCGCGACGTCATGAAGAAGATCTTCGATTCGCCCGACGAGCAACTC
CCCTGCAATCTCGTCAATGCCGCGGCTGGTGATCGCTGCAGCTGGTTCGTCGACGAGGCAGCCGTCGAGGGCGTT
TCTTTCCCGAGAAAGGCTTTTCTGTAGGTCGTTTTTTTGGCTTATCATGCATGGCATTTGACCGTTCGCGAGCGG
CGAGAATAGCAAGCCCTCCAGGCTTCATCCATCTAACCTGACGACGACGACGGGATGTGATGGAGGACCAAGAGT
CTGATTTTCGCTTCCATAGACGGACTGCTTGCCGATGATGTGCGCTGTCCGTCATCGTCAACCTCGCCATACATA
CATACCTATGCATATGTATGCTCTATGTATGCATAAGTGCCCGCCATCGCCGAGGCTATGCCGGGTTATAGACAG
TCCATCTTCTCTCAACGAACCCCCCCCCCCCCCCGAAGACGGCCAGTGACCAGAATCTACGCATCTCTCCATCCA
GCCCCTCCTTCATCCAGGGTATCGTCATGACCATGCCCAACCATTCTCTCAACCCACTCCACCTCCCTCGCCCGC
ACCTCCCGCTCGATATCCTCCATGATGCTCAGCTCAGACATCATCACCCGCAACAGCTTCTTCGTACCAGCCAGC
ACCCGTTCCGGACCCGACAAGGTCGTAGAGGTCTTCCCATCGTCACCTTGCTCCTCCTCCTTCTGCTCCTCCTCC
TTCTGCTCCTCCTCCTTCTGCTCCTCCTCCTCCTGATCCTCATCACCACCCACCTGCCGTAGCCTCGCCCTCCAA
CCCCCCAACCACCCCATCAAAACAACACACTCCTCCCTCCAACCCCCCTCCAGCCCATCAAGAAACCCCCATCCT
CACCGCCCAAACCCTCCCTCCTCACCCTCTCAACCTCCCCGACCCCCTCAACCCACCTCTCAAACCCCCTAACCG
CACACGCGTACCGGCCCCCCCCTCACACAAGGCCCAAAGCCCACCCAAGACCTCGCCCAAAACCTGCAGGCCGAG
ATCGAGATCCCCCCCCCATCGCCTCAACGTCCGCAAAGCATCAGCCTCGTCCAAGGCCATCTCGCGGCTTTCCAG
CTCGGCGCCCGCGCGCGAAACAGAGGCGAAGCGCTGGCCGAGCTTCTCGCGCGCGCTGGCGTGCCACTGCGCTTC
AGCGGTCAGGGCGTCGCGGTGGAGGAGGTGCAGTTGTAGGACTTGGGCTTGGAGGCGTTGGACTTGGGCTGAGGA
GGTGGTGGTGGTGGAGGAGGAGGAGGTTTTGATGGGCTGTTTGGAGGGAGAGGAGGGACGGAGGAAAGTTGATGT
TGCGGGTTTGGGCGCGGGTTTCTTGCCGGGCGTGTAGTGCTGCTGAAGCGTAGAGAAGGCCGGTCTCGTCGTCAT
CTTCGTCGTCGTCGTCGTCGTCGTCGTAGCCTTCTTCTTCTCTTCTTGCGGAGCAGATAGACCAGCCGTGACGGT
ACTCCTGGCACGCGCATGCATCGCACCACGTCTAACCCCGACGCCCGACCCGGGAACAGCATCCGTCCGACTCGA
CGTCGACGCCGAACGCCCCAGCGTCATCGCGCTCCGACCCTTCGTCGTCGTCGTCGTCGTCGGTGGAGGAGGAGG
CGGCATCATGGCAGCGGATCCCGGTCTCGCCGCACCACCGCGCGGAGTCGGAGTCGCCGTCGTGGACCGCGCGCT
CCCTCCCGGCTTCACCGGCAGCCGGCTGGGCGAGATCGACTCTCCCGGCCTCGGACCCGTGCGCTGGGATCGACT
GCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail