Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06506
Gene name
Locationscaffold_08:290354..292761
Strand-
Gene length (bp)2407
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase 3.4E-70 13 233

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 293 315 22
2 356 378 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06506
MAKSQPNLYAFPDVDALAPALRAYVLQCQSAAFDRHGTFKVAVSGGSLPKTLAAALLDCPSIDWSRWEIFFADER
AVPLDDPESNYALVKKDMLDRLPKDTAQPVVHPINVDLLDEGVQAVADAYERTLVGSFASRDSVRLPIFDLVLLG
CGPDGHTCSLFPGHALLRETDAWVAPIQDSPKPPPRRITLTLPVVTHAIRAAFVATGASKRDVMKKIFDSPDEQL
PCNLVNAAAGDRCSCISLVQGHLAAFQLGARARNRGEALAELLARAGVPLRFSGQGVAVEEVQFVEKAGLVVIFV
VVVVVVVAFFFSSCGADRPAVTVLLARACIAPRLTPTPDPGTASVRLDVDAERPSVIALRPFVVVVVVGGGGGGI
MAADPGLAAPPRGVGVAVVDRALPPGFTGSRLGEIDSPGLGPVRWDRLR*
Coding >Ophcf2|06506
ATGGCCAAGTCACAGCCCAACCTCTACGCCTTCCCCGACGTCGACGCCCTCGCTCCCGCCCTCCGCGCCTACGTC
CTTCAATGTCAATCCGCCGCCTTCGACCGCCACGGCACCTTCAAGGTAGCCGTCTCAGGCGGATCGCTGCCCAAG
ACTCTGGCAGCCGCCCTGCTCGACTGCCCGTCCATCGACTGGTCACGGTGGGAAATCTTCTTCGCCGATGAGCGC
GCCGTTCCCCTCGACGACCCCGAATCCAACTACGCGCTCGTCAAGAAGGACATGTTGGATCGTCTGCCCAAGGAT
ACGGCCCAGCCGGTCGTGCACCCCATCAACGTCGACCTCCTCGACGAAGGCGTCCAGGCCGTGGCGGACGCGTAC
GAGAGGACGTTAGTGGGTAGCTTCGCAAGCCGCGACTCCGTCCGCCTCCCCATCTTCGACCTCGTCCTCCTCGGA
TGCGGACCCGACGGACACACCTGCTCCCTCTTCCCCGGCCACGCCCTTCTCCGCGAGACAGACGCCTGGGTGGCG
CCCATCCAAGACTCGCCCAAGCCTCCACCCCGACGGATCACGCTGACGCTTCCCGTCGTGACGCACGCCATCCGT
GCCGCCTTTGTCGCTACCGGTGCCTCTAAGCGCGACGTCATGAAGAAGATCTTCGATTCGCCCGACGAGCAACTC
CCCTGCAATCTCGTCAATGCCGCGGCTGGTGATCGCTGCAGCTGCATCAGCCTCGTCCAAGGCCATCTCGCGGCT
TTCCAGCTCGGCGCCCGCGCGCGAAACAGAGGCGAAGCGCTGGCCGAGCTTCTCGCGCGCGCTGGCGTGCCACTG
CGCTTCAGCGGTCAGGGCGTCGCGGTGGAGGAGGTGCAGTTCGTAGAGAAGGCCGGTCTCGTCGTCATCTTCGTC
GTCGTCGTCGTCGTCGTCGTAGCCTTCTTCTTCTCTTCTTGCGGAGCAGATAGACCAGCCGTGACGGTACTCCTG
GCACGCGCATGCATCGCACCACGTCTAACCCCGACGCCCGACCCGGGAACAGCATCCGTCCGACTCGACGTCGAC
GCCGAACGCCCCAGCGTCATCGCGCTCCGACCCTTCGTCGTCGTCGTCGTCGTCGGTGGAGGAGGAGGCGGCATC
ATGGCAGCGGATCCCGGTCTCGCCGCACCACCGCGCGGAGTCGGAGTCGCCGTCGTGGACCGCGCGCTCCCTCCC
GGCTTCACCGGCAGCCGGCTGGGCGAGATCGACTCTCCCGGCCTCGGACCCGTGCGCTGGGATCGACTGCGCTGA
Transcript >Ophcf2|06506
ATGGCCAAGTCACAGCCCAACCTCTACGCCTTCCCCGACGTCGACGCCCTCGCTCCCGCCCTCCGCGCCTACGTC
CTTCAATGTCAATCCGCCGCCTTCGACCGCCACGGCACCTTCAAGGTAGCCGTCTCAGGCGGATCGCTGCCCAAG
ACTCTGGCAGCCGCCCTGCTCGACTGCCCGTCCATCGACTGGTCACGGTGGGAAATCTTCTTCGCCGATGAGCGC
GCCGTTCCCCTCGACGACCCCGAATCCAACTACGCGCTCGTCAAGAAGGACATGTTGGATCGTCTGCCCAAGGAT
ACGGCCCAGCCGGTCGTGCACCCCATCAACGTCGACCTCCTCGACGAAGGCGTCCAGGCCGTGGCGGACGCGTAC
GAGAGGACGTTAGTGGGTAGCTTCGCAAGCCGCGACTCCGTCCGCCTCCCCATCTTCGACCTCGTCCTCCTCGGA
TGCGGACCCGACGGACACACCTGCTCCCTCTTCCCCGGCCACGCCCTTCTCCGCGAGACAGACGCCTGGGTGGCG
CCCATCCAAGACTCGCCCAAGCCTCCACCCCGACGGATCACGCTGACGCTTCCCGTCGTGACGCACGCCATCCGT
GCCGCCTTTGTCGCTACCGGTGCCTCTAAGCGCGACGTCATGAAGAAGATCTTCGATTCGCCCGACGAGCAACTC
CCCTGCAATCTCGTCAATGCCGCGGCTGGTGATCGCTGCAGCTGCATCAGCCTCGTCCAAGGCCATCTCGCGGCT
TTCCAGCTCGGCGCCCGCGCGCGAAACAGAGGCGAAGCGCTGGCCGAGCTTCTCGCGCGCGCTGGCGTGCCACTG
CGCTTCAGCGGTCAGGGCGTCGCGGTGGAGGAGGTGCAGTTCGTAGAGAAGGCCGGTCTCGTCGTCATCTTCGTC
GTCGTCGTCGTCGTCGTCGTAGCCTTCTTCTTCTCTTCTTGCGGAGCAGATAGACCAGCCGTGACGGTACTCCTG
GCACGCGCATGCATCGCACCACGTCTAACCCCGACGCCCGACCCGGGAACAGCATCCGTCCGACTCGACGTCGAC
GCCGAACGCCCCAGCGTCATCGCGCTCCGACCCTTCGTCGTCGTCGTCGTCGTCGGTGGAGGAGGAGGCGGCATC
ATGGCAGCGGATCCCGGTCTCGCCGCACCACCGCGCGGAGTCGGAGTCGCCGTCGTGGACCGCGCGCTCCCTCCC
GGCTTCACCGGCAGCCGGCTGGGCGAGATCGACTCTCCCGGCCTCGGACCCGTGCGCTGGGATCGACTGCGCTGA
Gene >Ophcf2|06506
ATGGCCAAGTCACAGCCCAACCTCTACGCCTTCCCCGACGTCGACGCCCTCGCTCCCGCCCTCCGCGCCTACGTC
CTTCAATGTCAATCCGCCGCCTTCGACCGCCACGGCACCTTCAAGGTAGCCGTCTCAGGCGGATCGCTGCCCAAG
ACTCTGGCAGCCGCCCTGCTCGACTGCCCGTCCATCGACTGGTCACGGTGGGAAATCTTCTTCGCCGATGAGCGC
GCCGTTCCCCTCGACGACCCCGAATCCAACTACGCGCTCGTCAAGAAGGACATGTTGGATCGTCTGCCCAAGGAT
ACGGCCCAGCCGGTCGTGCACCCCATCAACGTCGACCTCCTCGACGAAGGCGTCCAGGCCGTGGCGGACGCGTAC
GAGAGGACGTTAGTGGGTAGCTTCGCAAGCCGCGACTCCGTCCGCCTCCCCATCTTCGACCTCGTCCTCCTCGGA
TGCGGACCCGACGGACACACCTGCTCCCTCTTCCCCGGCCACGCCCTTCTCCGCGAGACAGACGCCTGGGTGGCG
CCCATCCAAGACTCGCCCAAGCCTCCACCCCGACGGATCACGCTGACGCTTCCCGTCGTGACGCACGCCATCCGT
GCCGCCTTTGTCGCTACCGGTGCCTCTAAGCGCGACGTCATGAAGAAGATCTTCGATTCGCCCGACGAGCAACTC
CCCTGCAATCTCGTCAATGCCGCGGCTGGTGATCGCTGCAGCTGGTTCGTCGACGAGGCAGCCGTCGAGGGCGTT
TCTTTCCCGAGAAAGGCTTTTCTGTAGGTCGTTTTTTTGGCTTATCATGCATGGCATTTGACCGTTCGCGAGCGG
CGAGAATAGCAAGCCCTCCAGGCTTCATCCATCTAACCTGACGACGACGACGGGATGTGATGGAGGACCAAGAGT
CTGATTTTCGCTTCCATAGACGGACTGCTTGCCGATGATGTGCGCTGTCCGTCATCGTCAACCTCGCCATACATA
CATACCTATGCATATGTATGCTCTATGTATGCATAAGTGCCCGCCATCGCCGAGGCTATGCCGGGTTATAGACAG
TCCATCTTCTCTCAACGAACCCCCCCCCCCCCCCGAAGACGGCCAGTGACCAGAATCTACGCATCTCTCCATCCA
GCCCCTCCTTCATCCAGGGTATCGTCATGACCATGCCCAACCATTCTCTCAACCCACTCCACCTCCCTCGCCCGC
ACCTCCCGCTCGATATCCTCCATGATGCTCAGCTCAGACATCATCACCCGCAACAGCTTCTTCGTACCAGCCAGC
ACCCGTTCCGGACCCGACAAGGTCGTAGAGGTCTTCCCATCGTCACCTTGCTCCTCCTCCTTCTGCTCCTCCTCC
TTCTGCTCCTCCTCCTTCTGCTCCTCCTCCTCCTGATCCTCATCACCACCCACCTGCCGTAGCCTCGCCCTCCAA
CCCCCCAACCACCCCATCAAAACAACACACTCCTCCCTCCAACCCCCCTCCAGCCCATCAAGAAACCCCCATCCT
CACCGCCCAAACCCTCCCTCCTCACCCTCTCAACCTCCCCGACCCCCTCAACCCACCTCTCAAACCCCCTAACCG
CACACGCGTACCGGCCCCCCCCTCACACAAGGCCCAAAGCCCACCCAAGACCTCGCCCAAAACCTGCAGGCCGAG
ATCGAGATCCCCCCCCCATCGCCTCAACGTCCGCAAAGCATCAGCCTCGTCCAAGGCCATCTCGCGGCTTTCCAG
CTCGGCGCCCGCGCGCGAAACAGAGGCGAAGCGCTGGCCGAGCTTCTCGCGCGCGCTGGCGTGCCACTGCGCTTC
AGCGGTCAGGGCGTCGCGGTGGAGGAGGTGCAGTTGTAGGACTTGGGCTTGGAGGCGTTGGACTTGGGCTGAGGA
GGTGGTGGTGGTGGAGGAGGAGGAGGTTTTGATGGGCTGTTTGGAGGGAGAGGAGGGACGGAGGAAAGTTGATGT
TGCGGGTTTGGGCGCGGGTTTCTTGCCGGGCGTGTAGTGCTGCTGAAGCGTAGAGAAGGCCGGTCTCGTCGTCAT
CTTCGTCGTCGTCGTCGTCGTCGTCGTAGCCTTCTTCTTCTCTTCTTGCGGAGCAGATAGACCAGCCGTGACGGT
ACTCCTGGCACGCGCATGCATCGCACCACGTCTAACCCCGACGCCCGACCCGGGAACAGCATCCGTCCGACTCGA
CGTCGACGCCGAACGCCCCAGCGTCATCGCGCTCCGACCCTTCGTCGTCGTCGTCGTCGTCGGTGGAGGAGGAGG
CGGCATCATGGCAGCGGATCCCGGTCTCGCCGCACCACCGCGCGGAGTCGGAGTCGCCGTCGTGGACCGCGCGCT
CCCTCCCGGCTTCACCGGCAGCCGGCTGGGCGAGATCGACTCTCCCGGCCTCGGACCCGTGCGCTGGGATCGACT
GCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail