Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06504
Gene name
Locationscaffold_08:283930..286378
Strand+
Gene length (bp)2448
Transcript length (bp)2145
Coding sequence length (bp)2145
Protein length (aa) 715

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 2.3E-25 89 323

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7438 0.3621 0.0195 0.2178 0.0677 0.0056 0.1493 0.2336 0.2519 0.0157

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4519
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7519
Ophiocordyceps australis map64 (Brazil) OphauB2|5152
Ophiocordyceps camponoti-floridani Ophcf2|06504 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7115
Ophiocordyceps kimflemingae Ophio5|4464
Ophiocordyceps subramaniannii Hirsu2|9440

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06504
MRSIDETLSRWKATVECGDSLADLQGAVRNNGPASPCLIGCRSVCWKTFILAVPLAELSQALQDGRREYGQRRSQ
LLNFIEHPEALTQLSIDPLTDDPKSPWNTLRQDETMRKEIQQDVQRLPDEANYHQDRAQAMIINILFMYCKLHPN
RGGYRQGMHELLAPIVHVVEQDAIDRSGASSLDESMLVVVDSSYVEHDAYMLFSRLMEHAQVFYELREASTPSRS
SRTNDGTPEQTSTIVEKSRFIHQVCLRRLDEELATHLVDMEVLPQIFLIRWIRLLFSREFPFDQVLYLWDAIFAV
DPSLHLIDFICCAMLLRIRWQLLEADYATCLQLLLKYPQPTPSHGPHTFVDDAIYLQTHAYASGGQTLISKYSGR
RPQSPSPSRRARTRTAGGRQHSESPRRKTYSGRSPLSSPPRFIQHQGGVESLFQGAAKSAKGVLERGEKLGLNSA
VREAVGEIRRNVQMFNESRQLHRSPRADDGAAGALAAMERRNTQLAALLEETVASLKSISRSSLDDKTKSLDVIE
LAAAKVQFVQLYLGDSSMEMPAAEAADEGEAETKSEHSIDVAKKEGSVETGQYQSPPPPPESIDEPTANGDACAR
QDPKQETPAKVEGARDGSDRSGETSRPAGPMPTRSTLAQSSFSWMLEPDAPSRSPSVPSTGRQHQHRKRPSSNAS
RDRNAFLFGEGMADGDRGPTAQGDEIFGLEPMGKTKDRA*
Coding >Ophcf2|06504
ATGAGGTCCATCGACGAGACGCTGTCGAGATGGAAAGCAACCGTCGAATGCGGCGACAGCCTCGCCGACTTACAA
GGCGCTGTAAGAAACAATGGCCCCGCAAGCCCGTGCCTCATCGGCTGTCGCTCTGTGTGCTGGAAGACGTTCATC
TTGGCTGTTCCTCTCGCGGAACTGTCACAGGCTCTACAAGACGGCAGACGCGAGTACGGCCAGCGCAGAAGCCAG
CTCCTCAACTTCATCGAGCATCCGGAAGCCTTGACTCAGCTCTCAATCGACCCGCTGACCGACGACCCCAAGTCT
CCATGGAACACACTGCGTCAGGACGAGACGATGCGCAAGGAGATTCAACAGGACGTCCAGCGGCTTCCGGACGAG
GCCAACTATCACCAAGATCGGGCTCAGGCCATGATTATCAACATCCTCTTTATGTACTGCAAGCTTCACCCGAAC
CGAGGGGGATATCGCCAGGGAATGCATGAGCTTCTGGCCCCCATCGTGCACGTCGTGGAGCAGGACGCCATAGAT
CGATCCGGCGCATCGTCTCTGGACGAGTCCATGCTCGTCGTCGTCGATTCGTCGTACGTCGAGCACGATGCTTAC
ATGTTGTTTTCGCGGCTCATGGAGCACGCCCAGGTGTTTTACGAGCTGAGGGAGGCCAGTACTCCGTCGCGATCA
TCGCGGACAAATGACGGCACCCCCGAACAGACGTCGACCATTGTGGAGAAGAGCAGGTTCATCCACCAGGTCTGC
CTGCGCAGACTGGACGAAGAACTGGCAACACATCTGGTAGACATGGAGGTGTTGCCACAAATATTCCTCATCCGA
TGGATACGACTGCTCTTTAGTCGAGAGTTTCCCTTTGACCAAGTCTTATACCTCTGGGATGCCATCTTCGCCGTC
GATCCCTCTCTCCACTTGATAGACTTCATCTGCTGTGCCATGCTGCTCCGCATCCGTTGGCAACTGCTGGAAGCC
GACTACGCCACCTGTCTACAGCTTCTTTTGAAGTATCCTCAGCCGACTCCGTCACATGGACCACACACCTTTGTC
GACGACGCCATCTACCTTCAGACCCATGCATATGCGTCGGGAGGGCAGACCCTCATCAGCAAGTACAGTGGCAGA
AGGCCGCAATCGCCAAGCCCGTCACGCCGCGCTCGAACGAGAACAGCCGGAGGTCGTCAACATTCGGAGTCTCCT
CGACGGAAAACGTACAGCGGAAGATCACCGCTCTCGTCACCGCCGCGGTTCATACAACACCAAGGCGGCGTGGAG
TCCTTGTTTCAGGGCGCGGCAAAGAGCGCAAAGGGGGTCCTGGAACGGGGAGAGAAGCTCGGGCTCAACAGCGCT
GTGCGAGAGGCAGTGGGGGAGATCCGGCGAAACGTGCAGATGTTCAACGAGTCCCGACAGCTACACCGGTCACCC
CGGGCCGACGACGGCGCAGCGGGGGCTCTGGCCGCAATGGAGAGGCGTAACACGCAGCTGGCAGCACTCCTGGAA
GAGACGGTGGCCAGTCTCAAATCCATTTCCCGGTCGAGCCTCGATGACAAGACCAAGAGCCTAGACGTGATAGAG
CTCGCGGCAGCCAAGGTCCAATTCGTCCAGCTGTATCTGGGTGATTCGTCCATGGAGATGCCGGCCGCGGAAGCA
GCAGACGAAGGCGAAGCCGAGACGAAGAGCGAGCACAGCATCGACGTCGCCAAGAAGGAGGGATCCGTCGAGACC
GGACAGTATCAGTCGCCGCCGCCGCCGCCAGAAAGCATTGATGAGCCCACAGCCAACGGCGACGCATGCGCAAGG
CAGGACCCGAAGCAGGAAACCCCTGCCAAGGTCGAGGGAGCAAGGGACGGCTCGGACCGCAGCGGCGAGACGTCT
CGTCCAGCGGGGCCGATGCCCACGCGATCGACGCTCGCGCAATCTTCGTTCTCGTGGATGCTGGAGCCAGACGCC
CCCAGCCGTAGCCCGAGCGTGCCGTCAACGGGAAGACAACATCAGCACAGAAAGCGGCCATCGAGCAACGCCAGC
CGAGACAGGAATGCGTTCCTGTTCGGCGAGGGCATGGCAGACGGAGACAGAGGGCCAACGGCGCAGGGAGATGAG
ATTTTCGGGCTGGAACCGATGGGCAAGACCAAGGACAGGGCGTGA
Transcript >Ophcf2|06504
ATGAGGTCCATCGACGAGACGCTGTCGAGATGGAAAGCAACCGTCGAATGCGGCGACAGCCTCGCCGACTTACAA
GGCGCTGTAAGAAACAATGGCCCCGCAAGCCCGTGCCTCATCGGCTGTCGCTCTGTGTGCTGGAAGACGTTCATC
TTGGCTGTTCCTCTCGCGGAACTGTCACAGGCTCTACAAGACGGCAGACGCGAGTACGGCCAGCGCAGAAGCCAG
CTCCTCAACTTCATCGAGCATCCGGAAGCCTTGACTCAGCTCTCAATCGACCCGCTGACCGACGACCCCAAGTCT
CCATGGAACACACTGCGTCAGGACGAGACGATGCGCAAGGAGATTCAACAGGACGTCCAGCGGCTTCCGGACGAG
GCCAACTATCACCAAGATCGGGCTCAGGCCATGATTATCAACATCCTCTTTATGTACTGCAAGCTTCACCCGAAC
CGAGGGGGATATCGCCAGGGAATGCATGAGCTTCTGGCCCCCATCGTGCACGTCGTGGAGCAGGACGCCATAGAT
CGATCCGGCGCATCGTCTCTGGACGAGTCCATGCTCGTCGTCGTCGATTCGTCGTACGTCGAGCACGATGCTTAC
ATGTTGTTTTCGCGGCTCATGGAGCACGCCCAGGTGTTTTACGAGCTGAGGGAGGCCAGTACTCCGTCGCGATCA
TCGCGGACAAATGACGGCACCCCCGAACAGACGTCGACCATTGTGGAGAAGAGCAGGTTCATCCACCAGGTCTGC
CTGCGCAGACTGGACGAAGAACTGGCAACACATCTGGTAGACATGGAGGTGTTGCCACAAATATTCCTCATCCGA
TGGATACGACTGCTCTTTAGTCGAGAGTTTCCCTTTGACCAAGTCTTATACCTCTGGGATGCCATCTTCGCCGTC
GATCCCTCTCTCCACTTGATAGACTTCATCTGCTGTGCCATGCTGCTCCGCATCCGTTGGCAACTGCTGGAAGCC
GACTACGCCACCTGTCTACAGCTTCTTTTGAAGTATCCTCAGCCGACTCCGTCACATGGACCACACACCTTTGTC
GACGACGCCATCTACCTTCAGACCCATGCATATGCGTCGGGAGGGCAGACCCTCATCAGCAAGTACAGTGGCAGA
AGGCCGCAATCGCCAAGCCCGTCACGCCGCGCTCGAACGAGAACAGCCGGAGGTCGTCAACATTCGGAGTCTCCT
CGACGGAAAACGTACAGCGGAAGATCACCGCTCTCGTCACCGCCGCGGTTCATACAACACCAAGGCGGCGTGGAG
TCCTTGTTTCAGGGCGCGGCAAAGAGCGCAAAGGGGGTCCTGGAACGGGGAGAGAAGCTCGGGCTCAACAGCGCT
GTGCGAGAGGCAGTGGGGGAGATCCGGCGAAACGTGCAGATGTTCAACGAGTCCCGACAGCTACACCGGTCACCC
CGGGCCGACGACGGCGCAGCGGGGGCTCTGGCCGCAATGGAGAGGCGTAACACGCAGCTGGCAGCACTCCTGGAA
GAGACGGTGGCCAGTCTCAAATCCATTTCCCGGTCGAGCCTCGATGACAAGACCAAGAGCCTAGACGTGATAGAG
CTCGCGGCAGCCAAGGTCCAATTCGTCCAGCTGTATCTGGGTGATTCGTCCATGGAGATGCCGGCCGCGGAAGCA
GCAGACGAAGGCGAAGCCGAGACGAAGAGCGAGCACAGCATCGACGTCGCCAAGAAGGAGGGATCCGTCGAGACC
GGACAGTATCAGTCGCCGCCGCCGCCGCCAGAAAGCATTGATGAGCCCACAGCCAACGGCGACGCATGCGCAAGG
CAGGACCCGAAGCAGGAAACCCCTGCCAAGGTCGAGGGAGCAAGGGACGGCTCGGACCGCAGCGGCGAGACGTCT
CGTCCAGCGGGGCCGATGCCCACGCGATCGACGCTCGCGCAATCTTCGTTCTCGTGGATGCTGGAGCCAGACGCC
CCCAGCCGTAGCCCGAGCGTGCCGTCAACGGGAAGACAACATCAGCACAGAAAGCGGCCATCGAGCAACGCCAGC
CGAGACAGGAATGCGTTCCTGTTCGGCGAGGGCATGGCAGACGGAGACAGAGGGCCAACGGCGCAGGGAGATGAG
ATTTTCGGGCTGGAACCGATGGGCAAGACCAAGGACAGGGCGTGA
Gene >Ophcf2|06504
ATGAGGTCCATCGACGAGACGCTGTGAGTTGTGTGCCTCATCATATGTTCCTGCGGAGAGGGAAGGCGGGGCAAG
GCTGACGCGACTCTCCTCTTCCAGGTCGAGATGGAAAGCAACCGTCGAATGCGGCGACAGCCTCGCCGACTTACA
AGGCGCTGTAAGAAACAATGGCCCCGCAAGCCCGTGCCTCATCGGCTGTCGCTCTGTGTGCTGGAAGGTGTGTCG
TTCTGGGCTCGCGCGCTGCTCGTACCTGGTAATTGACCATCGCTGGCTCTGCAAGACGTTCATCTTGGCTGTTCC
TCTCGCGGAACTGTCACAGGCTCTACAAGACGGCAGACGCGAGTACGGCCAGCGCAGAAGCCAGCTCCTCAACTT
CATCGAGCATCCGGAAGCCTTGACTCAGCTCTCAATCGACCCGCTGACCGACGACCCCAAGGTAAGCTGACGCCC
GAAGGCGGTCCTGGCAGGCCACGCTGATGGCGTCGCAAGTCTCCATGGAACACACTGCGTCAGGACGAGACGATG
CGCAAGGAGATTCAACAGGACGTCCAGCGGCTTCCGGACGAGGCCAACTATCACCAAGATCGGGCTCAGGCCATG
ATTATCAACATCCTCTTTATGTACTGCAAGCTTCACCCGAACCGAGGGGGATATCGCCAGGGAATGCATGAGCTT
CTGGCCCCCATCGTGCACGTCGTGGAGCAGGACGCCATAGATCGATCCGGCGCATCGTCTCTGGACGAGTCCATG
CTCGTCGTCGTCGATTCGTCGTACGTCGAGCACGATGCTTACATGTTGTTTTCGCGGCTCATGGAGCACGCCCAG
GTGTTTTACGAGCTGAGGGAGGCCAGTACTCCGTCGCGATCATCGCGGACAAATGACGGCACCCCCGAACAGACG
TCGACCATTGTGGAGAAGAGCAGGTTCATCCACCAGGTCTGCCTGCGCAGACTGGACGAAGAACTGGCAACACAT
CTGGTAGACATGGAGGTGTTGCCACAAATATTCCTCATGTGAGTACTCTTTAGTCGTCCCGACCGCTCCGACTGG
GCCTGAAACCGCGAGATAGCCGATGGATACGACTGCTCTTTAGTCGAGAGTTTCCCTTTGACCAAGTCTTATACC
TCTGGGATGCCATCTTCGCCGTCGATCCCTCTCTCCACTTGATAGACTTCATCTGCTGTGCCATGCTGCTCCGCA
TCCGTTGGCAACGTGAGTACACGAGAGGCAATAACGGCTGGGCCCTCTTTTCTGACGTTTGAAGCAGTGCTGGAA
GCCGACTACGCCACCTGTCTACAGCTTCTTTTGAAGTATCCTCAGCCGACTCCGTCACATGGACCACACACCTTT
GTCGACGACGCCATCTACCTTCAGACCCATGCATATGCGTCGGGAGGGCAGACCCTCATCAGCAAGTACAGTGGC
AGAAGGCCGCAATCGCCAAGCCCGTCACGCCGCGCTCGAACGAGAACAGCCGGAGGTCGTCAACATTCGGAGTCT
CCTCGACGGAAAACGTACAGCGGAAGATCACCGCTCTCGTCACCGCCGCGGTTCATACAACACCAAGGCGGCGTG
GAGTCCTTGTTTCAGGGCGCGGCAAAGAGCGCAAAGGGGGTCCTGGAACGGGGAGAGAAGCTCGGGCTCAACAGC
GCTGTGCGAGAGGCAGTGGGGGAGATCCGGCGAAACGTGCAGATGTTCAACGAGTCCCGACAGCTACACCGGTCA
CCCCGGGCCGACGACGGCGCAGCGGGGGCTCTGGCCGCAATGGAGAGGCGTAACACGCAGCTGGCAGCACTCCTG
GAAGAGACGGTGGCCAGTCTCAAATCCATTTCCCGGTCGAGCCTCGATGACAAGACCAAGAGCCTAGACGTGATA
GAGCTCGCGGCAGCCAAGGTCCAATTCGTCCAGCTGTATCTGGGTGATTCGTCCATGGAGATGCCGGCCGCGGAA
GCAGCAGACGAAGGCGAAGCCGAGACGAAGAGCGAGCACAGCATCGACGTCGCCAAGAAGGAGGGATCCGTCGAG
ACCGGACAGTATCAGTCGCCGCCGCCGCCGCCAGAAAGCATTGATGAGCCCACAGCCAACGGCGACGCATGCGCA
AGGCAGGACCCGAAGCAGGAAACCCCTGCCAAGGTCGAGGGAGCAAGGGACGGCTCGGACCGCAGCGGCGAGACG
TCTCGTCCAGCGGGGCCGATGCCCACGCGATCGACGCTCGCGCAATCTTCGTTCTCGTGGATGCTGGAGCCAGAC
GCCCCCAGCCGTAGCCCGAGCGTGCCGTCAACGGGAAGACAACATCAGCACAGAAAGCGGCCATCGAGCAACGCC
AGCCGAGACAGGAATGCGTTCCTGTTCGGCGAGGGCATGGCAGACGGAGACAGAGGGCCAACGGCGCAGGGAGAT
GAGATTTTCGGGCTGGAACCGATGGGCAAGACCAAGGACAGGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail