Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06502
Gene name
Locationscaffold_08:278639..279880
Strand-
Gene length (bp)1241
Transcript length (bp)1116
Coding sequence length (bp)1116
Protein length (aa) 372

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 2.4E-09 50 109
PF00013 KH_1 KH domain 1.3E-12 136 197
PF00013 KH_1 KH domain 7.6E-16 290 354

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7278 0.5883 0.0763 0.0828 0.0753 0.0006 0.0967 0.0491 0.0314 0.0015

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1297
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2318
Ophiocordyceps australis map64 (Brazil) OphauB2|7918
Ophiocordyceps camponoti-floridani Ophcf2|06502 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5054
Ophiocordyceps kimflemingae Ophio5|4467
Ophiocordyceps subramaniannii Hirsu2|10602

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06502
MSVPQEIMSANGSDMAESMDQLKMDDRLGPDGEPAPKTDEEYAQAQLTLRAIVSSKEAGVIIGKGGKNVADLRDE
TGVKAGVSKVVQGVHDRVLTITGECDAISRAYAIVARALLEGAPAMGMGGIVQSSGTHPIKLLISHNQMGTIIGR
QGLKIKHIQDVSGVRMVAQKEMLPQSTERIVEVQGTPEGIQRAVWEICKCLVDDWQRGTGTVLYNPVVRTQPGGA
GGGMGGGGGYGSGRGEYSAPRVMRTGNGADFSNGGARPFHNRRSDSDAASRGPPTHDENGEEIQTQNISIPADMV
GCIIGRAGSKISEIRKTSGARISIAKAPHDETGERMFTIMGTAKANESALFLLYENLEAEKMRRSQVQDAE*
Coding >Ophcf2|06502
ATGTCAGTCCCTCAGGAAATCATGTCCGCCAACGGCAGCGACATGGCCGAGTCCATGGATCAGCTTAAGATGGAT
GACCGACTGGGCCCTGACGGAGAACCCGCCCCTAAGACGGATGAGGAATACGCCCAGGCCCAGCTCACCCTCCGA
GCCATAGTCTCGTCCAAGGAAGCCGGAGTCATAATCGGCAAAGGCGGCAAGAATGTCGCCGACCTGAGGGACGAG
ACGGGTGTCAAGGCCGGCGTCAGCAAAGTCGTTCAGGGCGTCCATGACCGTGTCCTCACCATCACCGGAGAATGC
GACGCCATCTCCAGAGCTTATGCCATCGTCGCCCGCGCACTGCTTGAGGGCGCACCTGCCATGGGCATGGGAGGC
ATCGTGCAGAGCAGCGGAACACACCCCATCAAGCTGCTCATCTCCCATAACCAGATGGGCACCATCATCGGCCGA
CAGGGCCTCAAGATCAAGCACATCCAAGATGTATCTGGCGTCCGCATGGTGGCCCAGAAGGAGATGCTGCCGCAG
TCTACCGAACGGATCGTCGAGGTGCAGGGCACCCCCGAGGGTATTCAGCGGGCCGTCTGGGAGATTTGCAAGTGT
CTGGTCGACGACTGGCAGCGTGGTACCGGCACCGTCCTCTACAATCCCGTCGTCCGCACCCAACCCGGTGGAGCC
GGAGGCGGTATGGGCGGCGGTGGCGGCTATGGCTCCGGAAGGGGCGAGTACTCGGCCCCTCGCGTGATGCGCACC
GGCAACGGAGCCGACTTTAGCAACGGCGGGGCGCGACCTTTCCACAATCGCCGGTCTGATTCCGACGCGGCTTCG
CGCGGTCCTCCCACGCACGACGAGAACGGCGAAGAGATTCAGACGCAGAACATCAGCATCCCTGCAGATATGGTT
GGCTGCATCATCGGCCGTGCAGGTAGTAAGATCAGCGAAATCCGCAAGACGTCGGGCGCTCGCATCTCCATTGCC
AAGGCCCCCCACGACGAGACGGGTGAGCGCATGTTCACCATCATGGGTACCGCCAAGGCCAACGAATCTGCCCTG
TTTCTCCTCTACGAGAACCTCGAGGCGGAGAAGATGAGGCGCAGCCAAGTCCAGGACGCCGAGTAG
Transcript >Ophcf2|06502
ATGTCAGTCCCTCAGGAAATCATGTCCGCCAACGGCAGCGACATGGCCGAGTCCATGGATCAGCTTAAGATGGAT
GACCGACTGGGCCCTGACGGAGAACCCGCCCCTAAGACGGATGAGGAATACGCCCAGGCCCAGCTCACCCTCCGA
GCCATAGTCTCGTCCAAGGAAGCCGGAGTCATAATCGGCAAAGGCGGCAAGAATGTCGCCGACCTGAGGGACGAG
ACGGGTGTCAAGGCCGGCGTCAGCAAAGTCGTTCAGGGCGTCCATGACCGTGTCCTCACCATCACCGGAGAATGC
GACGCCATCTCCAGAGCTTATGCCATCGTCGCCCGCGCACTGCTTGAGGGCGCACCTGCCATGGGCATGGGAGGC
ATCGTGCAGAGCAGCGGAACACACCCCATCAAGCTGCTCATCTCCCATAACCAGATGGGCACCATCATCGGCCGA
CAGGGCCTCAAGATCAAGCACATCCAAGATGTATCTGGCGTCCGCATGGTGGCCCAGAAGGAGATGCTGCCGCAG
TCTACCGAACGGATCGTCGAGGTGCAGGGCACCCCCGAGGGTATTCAGCGGGCCGTCTGGGAGATTTGCAAGTGT
CTGGTCGACGACTGGCAGCGTGGTACCGGCACCGTCCTCTACAATCCCGTCGTCCGCACCCAACCCGGTGGAGCC
GGAGGCGGTATGGGCGGCGGTGGCGGCTATGGCTCCGGAAGGGGCGAGTACTCGGCCCCTCGCGTGATGCGCACC
GGCAACGGAGCCGACTTTAGCAACGGCGGGGCGCGACCTTTCCACAATCGCCGGTCTGATTCCGACGCGGCTTCG
CGCGGTCCTCCCACGCACGACGAGAACGGCGAAGAGATTCAGACGCAGAACATCAGCATCCCTGCAGATATGGTT
GGCTGCATCATCGGCCGTGCAGGTAGTAAGATCAGCGAAATCCGCAAGACGTCGGGCGCTCGCATCTCCATTGCC
AAGGCCCCCCACGACGAGACGGGTGAGCGCATGTTCACCATCATGGGTACCGCCAAGGCCAACGAATCTGCCCTG
TTTCTCCTCTACGAGAACCTCGAGGCGGAGAAGATGAGGCGCAGCCAAGTCCAGGACGCCGAGTAG
Gene >Ophcf2|06502
ATGTCAGTCCCTCAGGAAATCATGTCCGCCAACGGCAGCGACATGGCCGAGTCCATGGATCAGCTTAAGATGGAT
GACCGACTGGGCCCTGACGGAGAACCCGCCCCTAAGACGGATGAGGAATACGCCCAGGCCCAGCTCACCCTCCGA
GCCATAGTCTCGTCCAAGGAAGCCGGAGTCATAATCGGCAAAGGCGGCAAGAATGTCGCCGACCTGAGGGACGAG
ACGGGTGTCAAGGCCGGCGTCAGCAAAGTCGTTCAGGGCGTCCATGACCGTGTCCTCACCATCACCGGAGAATGC
GACGCCATCTCCAGAGCTTATGCCATCGTCGCCCGCGCACTGCTTGAGGGCGCACCTGCCATGGGCATGGGAGGC
ATCGTGCAGAGCAGCGGAACACACCGTAAGTCTCCGGCGGCCACCGTTCGTTGTCTAGTCTCCGCTGACGCCCTT
CCTTCTCCACAGCCATCAAGCTGCTCATCTCCCATAACCAGATGGGCACCATCATCGGCCGACAGGGCCTCAAGA
TCAAGCACATCCAAGATGTATCTGGCGTCCGCATGGTGGCCCAGAAGGAGATGCTGCCGCAGTCTACCGAACGGA
TCGTCGAGGTGCAGGGCACCCCCGAGGGTATTCAGCGGGCCGTCTGGGAGATTTGCAAGTGTCTGGTCGACGACT
GGCAGCGTGGTACCGGCACCGTCCTCTACAATCCCGTCGTCCGCACCCAACCCGGTGGAGCCGGAGGCGGTATGG
GCGGCGGTGGCGGCTATGGCTCCGGAAGGGGCGAGTACTCGGCCCCTCGCGTGATGCGCACCGGCAACGGAGCCG
ACTTTAGCAACGGCGGGGCGCGACCTTTCCACAATCGCCGGTCTGATTCCGACGCGGCTTCGCGCGGTCCTCCCA
CGCACGACGAGAACGGCGAAGAGATTCAGACGCAGAACATCAGCATCCCTGCAGATATGGTTGGCTGCATCATCG
GCCGTGCAGGTAGTAAGATCAGCGAAATCCGCAAGACGTCGGGCGCTCGCATCTCCATTGCCAAGGTCAGTGGAC
TCGGGGGGGGGGGGGGGGGAGGACGTGTTGAGGGACAGTGCTGACCGGCGCAGGCCCCCCACGACGAGACGGGTG
AGCGCATGTTCACCATCATGGGTACCGCCAAGGCCAACGAATCTGCCCTGTTTCTCCTCTACGAGAACCTCGAGG
CGGAGAAGATGAGGCGCAGCCAAGTCCAGGACGCCGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail