Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06501
Gene name
Locationscaffold_08:276328..277568
Strand-
Gene length (bp)1240
Transcript length (bp)1137
Coding sequence length (bp)1137
Protein length (aa) 379

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08449 UAA UAA transporter family 6.0E-46 33 360
PF00892 EamA EamA-like transporter family 1.8E-06 242 356

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 66 88 22
3 108 130 22
4 134 156 22
5 163 185 22
6 195 217 22
7 238 260 22
8 298 320 22
9 345 362 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06501
MARSKQQQQQQRQKQAVSIHHGPRPPRQQLYQLAMAVAGIYGSFLTWAYLQEKLTTTGYGPNKERWRYPVVLNTL
QSVLAAVVGACYLIATRPRGGRIPAVITRREMVLPLVVVAVTSSLASPFGYASLAHIDYVTFLLAKSCKLLPVMG
LHVVLFGRRYPRYKYLVVGAVTAGVAVFTLYSSSGKKKGRTGGGGSMIWGLFLLCVNLLLDGLTNTTQDHIFRAY
APYSGPQMMCANNVLSSMVTGAYLLAGPLLAATSWARLFGLDAEAGGELSSAFAFIARHPSVWADLLGFALCGAI
GQVFIFYTLSTFSSVLLVTVTVTRKMVTMMLSVVAFGHRLGRMQWLGVGLVFGGIGLEALIARREKLVKEAAGDK
KKS*
Coding >Ophcf2|06501
ATGGCGCGGAGCAAGCAGCAGCAGCAGCAGCAGCGACAAAAGCAAGCCGTCTCCATCCACCATGGGCCTCGTCCT
CCTCGCCAGCAGCTGTACCAGCTGGCCATGGCGGTGGCGGGCATCTACGGCTCGTTCCTGACGTGGGCCTACCTC
CAGGAGAAGCTGACGACGACGGGCTACGGACCGAACAAGGAGCGATGGCGATACCCCGTCGTTCTGAACACGCTA
CAGTCCGTACTGGCAGCCGTGGTCGGGGCGTGCTACCTCATTGCGACGAGGCCTCGAGGCGGACGGATTCCGGCG
GTGATAACGAGGCGGGAGATGGTTTTGCCCCTCGTGGTCGTTGCGGTGACGAGCAGTCTGGCCAGTCCGTTTGGG
TACGCGAGTCTTGCGCACATCGACTACGTCACGTTTTTGCTGGCCAAGAGCTGTAAGCTTTTGCCGGTCATGGGG
TTGCATGTTGTTCTGTTCGGGAGGCGGTATCCGCGGTATAAGTACCTTGTTGTTGGGGCTGTTACTGCTGGTGTT
GCTGTCTTTACTCTTTACTCTTCGTCTGGGAAGAAGAAGGGGAGGACTGGCGGTGGTGGATCGATGATATGGGGT
CTCTTCCTACTCTGCGTCAACCTCCTGCTCGATGGCTTAACCAACACGACGCAGGATCACATCTTTCGCGCCTAC
GCTCCGTACTCGGGACCGCAGATGATGTGCGCCAACAACGTGCTCAGCTCCATGGTTACCGGTGCTTATCTCCTT
GCCGGGCCCCTTTTGGCCGCTACCTCTTGGGCCCGGCTTTTCGGTCTGGATGCTGAGGCGGGGGGCGAGTTATCT
TCTGCCTTTGCCTTCATCGCCCGTCATCCTTCTGTTTGGGCTGATTTATTGGGCTTTGCCCTCTGCGGCGCCATC
GGTCAAGTCTTCATCTTCTACACGCTCTCAACCTTCTCCTCAGTCCTCCTCGTCACCGTGACCGTCACGCGCAAA
ATGGTCACCATGATGCTCTCCGTCGTCGCCTTCGGCCACCGCCTCGGGCGCATGCAGTGGCTCGGCGTCGGCCTC
GTCTTTGGGGGTATCGGCCTCGAGGCTTTGATTGCTAGGAGGGAAAAGTTGGTGAAGGAGGCGGCTGGTGATAAA
AAGAAGTCTTGA
Transcript >Ophcf2|06501
ATGGCGCGGAGCAAGCAGCAGCAGCAGCAGCAGCGACAAAAGCAAGCCGTCTCCATCCACCATGGGCCTCGTCCT
CCTCGCCAGCAGCTGTACCAGCTGGCCATGGCGGTGGCGGGCATCTACGGCTCGTTCCTGACGTGGGCCTACCTC
CAGGAGAAGCTGACGACGACGGGCTACGGACCGAACAAGGAGCGATGGCGATACCCCGTCGTTCTGAACACGCTA
CAGTCCGTACTGGCAGCCGTGGTCGGGGCGTGCTACCTCATTGCGACGAGGCCTCGAGGCGGACGGATTCCGGCG
GTGATAACGAGGCGGGAGATGGTTTTGCCCCTCGTGGTCGTTGCGGTGACGAGCAGTCTGGCCAGTCCGTTTGGG
TACGCGAGTCTTGCGCACATCGACTACGTCACGTTTTTGCTGGCCAAGAGCTGTAAGCTTTTGCCGGTCATGGGG
TTGCATGTTGTTCTGTTCGGGAGGCGGTATCCGCGGTATAAGTACCTTGTTGTTGGGGCTGTTACTGCTGGTGTT
GCTGTCTTTACTCTTTACTCTTCGTCTGGGAAGAAGAAGGGGAGGACTGGCGGTGGTGGATCGATGATATGGGGT
CTCTTCCTACTCTGCGTCAACCTCCTGCTCGATGGCTTAACCAACACGACGCAGGATCACATCTTTCGCGCCTAC
GCTCCGTACTCGGGACCGCAGATGATGTGCGCCAACAACGTGCTCAGCTCCATGGTTACCGGTGCTTATCTCCTT
GCCGGGCCCCTTTTGGCCGCTACCTCTTGGGCCCGGCTTTTCGGTCTGGATGCTGAGGCGGGGGGCGAGTTATCT
TCTGCCTTTGCCTTCATCGCCCGTCATCCTTCTGTTTGGGCTGATTTATTGGGCTTTGCCCTCTGCGGCGCCATC
GGTCAAGTCTTCATCTTCTACACGCTCTCAACCTTCTCCTCAGTCCTCCTCGTCACCGTGACCGTCACGCGCAAA
ATGGTCACCATGATGCTCTCCGTCGTCGCCTTCGGCCACCGCCTCGGGCGCATGCAGTGGCTCGGCGTCGGCCTC
GTCTTTGGGGGTATCGGCCTCGAGGCTTTGATTGCTAGGAGGGAAAAGTTGGTGAAGGAGGCGGCTGGTGATAAA
AAGAAGTCTTGA
Gene >Ophcf2|06501
ATGGCGCGGAGCAAGCAGCAGCAGCAGCAGCAGCGACAAAAGCAAGCCGTCTCCATCCACCATGGGCCTCGTCCT
CCTCGCCAGCAGCTGTACCAGCTGGCCATGGCGGTGGCGGGCATCTACGGCTCGTTCCTGACGTGGGCCTACCTC
CAGGAGAAGCTGACGACGACGGGCTACGGACCGAACAAGGAGCGATGGCGATACCCCGTCGTTCTGAACACGCTA
CAGTCCGTACTGGCAGCCGTGGTCGGGGCGTGCTACCTCATTGCGACGAGGCCTCGAGGCGGACGGATTCCGGCG
GTGATAACGAGGCGGGAGATGGTTTTGCCCCTCGTGGTCGTTGCGGTGACGAGCAGTCTGGCCAGTCCGTTTGGG
TACGCGAGTCTTGCGCACATCGACTACGTCACGTTTTTGCTGGCCAAGAGCTGTAAGCTTTTGCCGGTCATGGGG
TTGCATGTTGTTCTGTTCGGGAGGCGGTATCCGCGGTATAAGTACCTTGTTGTTGGGGCTGTTACTGCTGGTGTT
GCTGTCTTTACTCTTTACTCTTCGTCTGGGAAGAAGAAGGGGAGGACTGGCGGTGGTGGATCGATGATATGGGGT
CTCTTCCTACTCTGCGTCAACCTCCTGCTCGATGGCTTAACCAACACGACGCAGGATCACATCTTTCGCGCCTAC
GCTCCGTACTCGGGACCGCAGATGATGTGCGCCAACAACGTGCTCAGCTCCATGGTTACCGGTGCTTATCTCCTT
GCCGGGCCCCTTTTGGCCGCTACCTCTTGGGCCCGGCTTTTCGGTCTGGATGCTGAGGCGGGGGGCGAGTTATCT
TCTGCCTTTGCCTTCATCGCCCGTCATCCTTCTGTTTGGGCTGATTTATTGGGCTTTGCCCTCTGCGGCGCCATC
GGTCAAGTCTTCATCTGTACGTTTCCCACCCCCCCCCATTCCTTTCTCCCTCGTCAATTCCAGGATACACTAACA
AGGGAAAACGAAAAAAAAAAAAAAAAAAAACACCCCAAATAAAGTCTACACGCTCTCAACCTTCTCCTCAGTCCT
CCTCGTCACCGTGACCGTCACGCGCAAAATGGTCACCATGATGCTCTCCGTCGTCGCCTTCGGCCACCGCCTCGG
GCGCATGCAGTGGCTCGGCGTCGGCCTCGTCTTTGGGGGTATCGGCCTCGAGGCTTTGATTGCTAGGAGGGAAAA
GTTGGTGAAGGAGGCGGCTGGTGATAAAAAGAAGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail