Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06484
Gene name
Locationscaffold_08:229402..230221
Strand+
Gene length (bp)819
Transcript length (bp)759
Coding sequence length (bp)759
Protein length (aa) 253

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09768 Peptidase_M76 Peptidase M76 family 2.5E-69 67 248

GO

GO Term Description Terminal node
GO:0004222 metalloendopeptidase activity Yes
GO:0008237 metallopeptidase activity No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0004175 endopeptidase activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion 0.3613 0.4834 0.5827 0.3426 0.7182 0.2086 0.1504 0.1264 0.0605 0.2669

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2072
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5951
Ophiocordyceps australis map64 (Brazil) OphauB2|7940
Ophiocordyceps camponoti-floridani Ophcf2|06484 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6010
Ophiocordyceps kimflemingae Ophio5|5464
Ophiocordyceps subramaniannii Hirsu2|2394

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06484
MDPQSDPSAAKATPSNDVVNDPARTGFDPQVRWWINYFRILSGQMNREGQFHYREWRYKVHEERDCKRCDQYRDW
LFTYSPIVRFLSEKVQDLNGNLDASNVVCRRCPARLGEDGQVRRQSGGFDPDRGILLCANEIRDRKHLEDTLAHE
MVHAWDHLRWKVDWRGDKDLRHAACTEIRASTLSGECRWTREAFTRGNWSVTQQFQRCVRRRAINSVMARPRCKG
KEHAAKVVDQVWDSCFSDTRPFDEVYR*
Coding >Ophcf2|06484
ATGGATCCCCAGTCCGATCCTTCAGCAGCAAAAGCCACGCCATCCAACGACGTCGTCAACGATCCGGCGCGCACT
GGCTTCGATCCCCAAGTCAGATGGTGGATCAACTACTTCCGCATCCTCTCGGGCCAGATGAACCGCGAGGGCCAG
TTCCACTACCGCGAATGGCGATACAAGGTTCACGAAGAGCGCGACTGCAAGCGCTGCGACCAGTATCGCGACTGG
CTGTTCACCTATTCGCCCATCGTTCGCTTCCTGTCCGAAAAGGTTCAGGATCTGAACGGGAACCTCGACGCCTCA
AACGTCGTCTGTCGCCGCTGTCCCGCGCGGCTCGGTGAAGACGGTCAGGTTCGTCGTCAGTCTGGCGGCTTCGAC
CCGGATCGTGGCATCCTGCTGTGCGCCAACGAGATCCGAGACCGCAAGCACCTGGAAGACACCCTGGCGCACGAG
ATGGTGCATGCCTGGGATCATCTGCGCTGGAAGGTCGACTGGAGGGGCGACAAGGACCTGCGGCATGCCGCCTGC
ACCGAGATTCGCGCATCGACTCTAAGCGGCGAGTGCCGGTGGACGAGAGAGGCCTTCACCAGAGGTAATTGGTCG
GTGACGCAGCAATTTCAGAGATGCGTGCGCAGGCGGGCCATCAACTCAGTCATGGCACGGCCGAGGTGCAAAGGC
AAGGAGCACGCGGCCAAGGTCGTCGACCAGGTCTGGGATTCGTGCTTTTCAGACACTCGTCCATTCGATGAGGTA
TATAGATGA
Transcript >Ophcf2|06484
ATGGATCCCCAGTCCGATCCTTCAGCAGCAAAAGCCACGCCATCCAACGACGTCGTCAACGATCCGGCGCGCACT
GGCTTCGATCCCCAAGTCAGATGGTGGATCAACTACTTCCGCATCCTCTCGGGCCAGATGAACCGCGAGGGCCAG
TTCCACTACCGCGAATGGCGATACAAGGTTCACGAAGAGCGCGACTGCAAGCGCTGCGACCAGTATCGCGACTGG
CTGTTCACCTATTCGCCCATCGTTCGCTTCCTGTCCGAAAAGGTTCAGGATCTGAACGGGAACCTCGACGCCTCA
AACGTCGTCTGTCGCCGCTGTCCCGCGCGGCTCGGTGAAGACGGTCAGGTTCGTCGTCAGTCTGGCGGCTTCGAC
CCGGATCGTGGCATCCTGCTGTGCGCCAACGAGATCCGAGACCGCAAGCACCTGGAAGACACCCTGGCGCACGAG
ATGGTGCATGCCTGGGATCATCTGCGCTGGAAGGTCGACTGGAGGGGCGACAAGGACCTGCGGCATGCCGCCTGC
ACCGAGATTCGCGCATCGACTCTAAGCGGCGAGTGCCGGTGGACGAGAGAGGCCTTCACCAGAGGTAATTGGTCG
GTGACGCAGCAATTTCAGAGATGCGTGCGCAGGCGGGCCATCAACTCAGTCATGGCACGGCCGAGGTGCAAAGGC
AAGGAGCACGCGGCCAAGGTCGTCGACCAGGTCTGGGATTCGTGCTTTTCAGACACTCGTCCATTCGATGAGGTA
TATAGATGA
Gene >Ophcf2|06484
ATGGATCCCCAGTCCGATCCTTCAGCAGCAAAAGCCACGCCATCCAACGACGTCGTCAACGATCCGGCGCGCACT
GGCTTCGATCCCCAAGTCAGATGGTGGATCAACTACTTCCGCATCCTCTCGGGCCAGATGAACCGCGAGGGCCAG
TTCCACTACCGCGAATGGCGATACAAGGTTCACGAAGAGCGCGACTGCAAGCGCTGCGACCAGTATCGCGACTGG
CTGTTCACCTATTCGCCCATCGTTCGCTTCCTGTCCGAAAAGGTTCAGGATCTGAACGGGAACCTCGACGCCTCA
AACGTCGTCTGTCGCCGCTGTCCCGCGCGGCTCGGTGAAGACGGTCAGGTTCGTCGTCAGTCTGGCGGCTTCGAC
CCGGATCGTGGCATCCTGCTGTGCGCCAACGAGATCCGAGACCGCAAGCACCTGGAAGACACCCTGGCGCACGAG
ATGGTGCATGCCTGGGATCATCTGCGCTGGAAGGTCGACTGGAGGGGCGACAAGGACCTGCGGCATGCCGCCTGC
ACCGAGGTGAGACCCTCCAAGCCTACCCATTCAGTTGGCTCCATATCGCTCACGGCTACATGCAAGATTCGCGCA
TCGACTCTAAGCGGCGAGTGCCGGTGGACGAGAGAGGCCTTCACCAGAGGTAATTGGTCGGTGACGCAGCAATTT
CAGAGATGCGTGCGCAGGCGGGCCATCAACTCAGTCATGGCACGGCCGAGGTGCAAAGGCAAGGAGCACGCGGCC
AAGGTCGTCGACCAGGTCTGGGATTCGTGCTTTTCAGACACTCGTCCATTCGATGAGGTATATAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail