Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06480
Gene name
Locationscaffold_08:211374..215039
Strand-
Gene length (bp)3665
Transcript length (bp)3531
Coding sequence length (bp)3531
Protein length (aa) 1177

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00806 PUF Pumilio-family RNA binding repeat 2.6E-06 661 693
PF00806 PUF Pumilio-family RNA binding repeat 4.1E-02 696 729
PF00806 PUF Pumilio-family RNA binding repeat 1.7E-02 739 756
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.8E-11 441 499

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7746 0.403 0.1068 0.0736 0.0911 0.0026 0.0857 0.1152 0.0389 0.0076

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup474
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5945
Ophiocordyceps australis map64 (Brazil) OphauB2|7945
Ophiocordyceps camponoti-floridani Ophcf2|06480 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1610
Ophiocordyceps camponoti-rufipedis Ophun1|2376
Ophiocordyceps kimflemingae Ophio5|8585
Ophiocordyceps subramaniannii Hirsu2|10454

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06480
MAPGYSPRRSAPQTRSQSPSAEARAHYALSHNGIMATNSRSGAGSPSHEMSGSGRPYPKRTREIQQEGKSAAPLN
MWSGPPTSGNSTPLRENIPESPTDGFPDFAQLPTPESLPPTRRARAGTVPSRFSPGGPLNVQNLAPKSARATPSA
PTPFNKSQSPSPSLDPPEGSSSSGSALLSRLRAGSMPQRSPFAPAPATAGSPFGPSIFSTGWNPAGVGRERGSTL
ASIASVGSNGPSSPAQSQFSSKEAVGESDVHMRTLDYLGLAETPQPPPRAQLATPYMANFDYTKQSSRFRSYSVN
NKDKYADEDDDDVDDYDVDAMHHPDSQYVAAALQDQLAATNVAIHNHNLAVQAFANQASVTRPRARTAGVLDSPG
SRLMRTYLTGGTAVAANPTAELREDEYDDLPQAVVAGMNLGRSSSRNAGGMLGAEDQGLEGPTSALWLGGMPTST
TTSTLIEMFKAHGPIVSARVLTHKNCGFVNFERVESAMSARSSLNGKEIFPGAGPIRINFAKPPSSANTPGHDGA
VPSPSPDPFSRSQDAGAASAAAAAAAGADGVHPASAAAAAGKTTPAVPPLRDMMTDIVDIVGQFGASDDDKAVIS
RSVQSAIQYKGFVEEIPAIREPTHTRVHDAPRLRDIRKRIDNQLLSQAEIEDVAMEMLPEIAELSSDYLGNTVVQ
KLFEHCGDPVRDAMLAEIGPHMAEIGIHKNGTWAAQKIIDVCKTSGQMSVIVDNLRPYTVPLFLDQYGNYVLQGC
LKFGTPYNEFIFETMLSRMWEVAQGRFGARAMRACLESHHASKNQQRMLAAAIALHSVQLATNANGALLLTWFLD
TCTFPQRRTVLSPRLVPCLVHLCTHKVAYLTVLKVINQKAEHNARDTILKALFFTPNDQVLEAILSDHACGSTLI
FKVLTTPFFDESIRARVVENVKNVLVRIKAQPGQGYKRLMDEVGLSTRTAGPGGREGGGNGHTDQQQQQQQQQQQ
QQQQQQQQQQQQQQRQRPASRHAGVNGGHHGQQAHGGGGKPFFASMNPGFDVGYGPPRNDGAADPGAVAGFQPYG
QGVVFGSPAGHVQQMQYQQGLMGRATPPMNYGFPPLQPGYGAYGGPASAVDQFRQQNMPNGSPIQPSSSSPQVPQ
MPGGQGPPPLGPPGFGLSMGGSYGYGGLVGMPNMGGYMPQEQQTSARRGRR*
Coding >Ophcf2|06480
ATGGCTCCTGGCTATTCCCCGCGCCGCTCCGCCCCCCAAACTCGCTCCCAATCGCCCTCCGCCGAAGCCAGAGCT
CATTACGCCCTCAGTCACAACGGCATCATGGCCACCAACTCGCGATCCGGGGCTGGTTCTCCGTCGCACGAAATG
TCCGGCTCGGGCCGGCCATACCCAAAGCGAACCAGAGAGATTCAGCAGGAGGGCAAGTCGGCAGCGCCCCTCAAC
ATGTGGAGCGGCCCTCCCACCAGCGGCAACTCGACCCCCCTCCGCGAGAACATACCCGAATCCCCCACAGACGGC
TTCCCCGACTTTGCCCAGCTGCCGACGCCCGAGAGCCTGCCGCCGACCAGGAGGGCCCGCGCCGGCACCGTCCCC
TCCCGCTTCTCCCCCGGCGGCCCGCTCAACGTCCAGAACCTGGCCCCAAAGTCGGCCCGTGCCACCCCGTCCGCC
CCGACGCCCTTCAACAAGTCCCAGTCGCCCTCCCCGAGCCTCGACCCGCCCGAGGGCTCGTCCTCGTCCGGCTCG
GCCCTCCTGTCCCGCCTCCGGGCGGGCTCCATGCCCCAGCGCAGCCCCTTCGCCCCCGCGCCCGCCACCGCCGGC
TCGCCTTTCGGCCCTTCCATCTTCAGCACCGGCTGGAACCCGGCTGGCGTCGGCCGTGAGCGGGGCTCCACCCTC
GCCAGCATCGCCAGCGTCGGCTCCAACGGGCCCAGCTCCCCGGCCCAGTCCCAGTTCTCCTCCAAGGAGGCCGTT
GGCGAGTCCGACGTGCACATGCGAACCCTCGACTACCTCGGTCTGGCCGAGACGCCGCAGCCGCCTCCAAGGGCC
CAGCTCGCCACGCCCTACATGGCCAACTTTGATTACACCAAGCAGTCGAGCCGCTTCCGCTCCTATTCCGTCAAT
AACAAGGACAAGTATGCCGACGAAGACGACGACGACGTCGACGACTACGACGTCGACGCCATGCACCACCCGGAC
AGCCAGTACGTCGCCGCCGCGCTGCAAGACCAGCTGGCCGCCACCAATGTCGCCATCCACAACCATAACCTGGCT
GTTCAGGCCTTTGCCAATCAGGCTTCGGTGACGCGGCCCCGCGCCCGCACCGCCGGCGTCCTCGACTCGCCTGGC
AGCCGCCTGATGAGGACGTACCTCACGGGCGGCACCGCCGTCGCCGCCAACCCCACGGCCGAGTTGCGCGAGGAC
GAGTACGACGACCTGCCCCAGGCCGTCGTGGCCGGCATGAACCTCGGCAGGTCCAGCAGCCGCAACGCCGGCGGC
ATGCTGGGCGCCGAGGATCAGGGGCTCGAGGGCCCGACGAGCGCCCTGTGGCTGGGCGGCATGCCCACGTCGACG
ACGACATCCACGCTCATCGAGATGTTCAAGGCCCACGGCCCCATCGTCTCGGCCCGCGTCCTGACGCACAAGAAC
TGCGGCTTCGTCAACTTCGAGAGGGTCGAGAGCGCCATGTCGGCCAGGTCCAGCCTCAACGGCAAGGAGATCTTC
CCCGGCGCCGGGCCCATCCGCATCAACTTCGCCAAGCCCCCCTCGTCGGCCAACACGCCCGGCCACGACGGCGCC
GTCCCGTCCCCCAGCCCGGACCCCTTTTCCAGGTCTCAGGACGCCGGCGCGGCCTCGGCGGCGGCGGCGGCGGCG
GCGGGCGCAGACGGCGTCCACCCGGCCTCGGCTGCGGCTGCGGCGGGCAAGACGACACCCGCCGTGCCGCCCTTG
CGCGACATGATGACGGACATTGTCGACATCGTCGGCCAGTTCGGGGCCTCGGACGACGACAAGGCGGTCATCTCG
CGCAGCGTGCAGTCGGCCATCCAGTACAAAGGCTTCGTCGAGGAGATTCCGGCCATCCGCGAACCCACGCACACG
CGGGTCCACGACGCGCCCAGGCTGAGAGACATTCGCAAGCGCATCGACAACCAGCTCTTGTCCCAGGCCGAGATC
GAGGACGTGGCCATGGAGATGCTGCCCGAGATCGCCGAGCTCTCGTCCGACTACCTGGGCAACACGGTGGTGCAG
AAGCTGTTCGAGCACTGCGGCGACCCCGTCAGGGACGCCATGCTGGCCGAGATCGGGCCTCACATGGCCGAGATC
GGCATCCACAAGAACGGCACGTGGGCGGCGCAGAAGATCATTGACGTGTGCAAGACGAGCGGGCAGATGTCGGTC
ATCGTCGACAACCTGCGGCCGTACACGGTGCCCCTGTTCCTGGACCAGTACGGCAACTACGTGCTTCAGGGGTGC
CTCAAGTTCGGCACGCCCTACAACGAGTTCATCTTCGAGACGATGCTGAGCAGGATGTGGGAAGTGGCCCAGGGC
CGCTTCGGCGCCCGCGCCATGAGGGCCTGTCTCGAGAGCCACCACGCCAGCAAGAACCAGCAGCGGATGCTGGCG
GCTGCCATCGCCCTCCATAGCGTCCAGCTGGCGACCAACGCCAACGGCGCCCTGCTCCTGACCTGGTTCCTCGAC
ACGTGCACCTTTCCCCAGCGGCGCACCGTCCTGTCGCCGCGCCTGGTGCCGTGTCTCGTCCACCTGTGCACACAC
AAGGTGGCCTACCTGACGGTGCTCAAGGTCATCAACCAGAAGGCGGAGCACAACGCGCGCGACACCATACTCAAG
GCCCTCTTCTTCACCCCAAACGATCAGGTGCTCGAGGCTATCCTGTCCGATCACGCATGCGGTTCGACGCTCATC
TTCAAGGTGCTTACCACCCCCTTTTTCGACGAGAGCATCCGTGCCCGCGTCGTCGAAAATGTCAAGAATGTGCTC
GTCAGGATCAAGGCCCAACCCGGTCAGGGCTACAAGCGTCTGATGGACGAGGTCGGACTTTCCACCAGGACGGCT
GGGCCGGGCGGCCGCGAAGGGGGTGGCAACGGCCACACCGACCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCAACAGCAGCAACAACAACAGCAGCAGCAGCAGCAGAGGCAGCGGCCGGCCTCGAGGCACGCCGGCGTC
AACGGTGGTCACCACGGGCAGCAGGCCCACGGCGGCGGTGGCAAGCCCTTCTTCGCCTCCATGAACCCCGGCTTC
GACGTGGGCTACGGGCCTCCTAGGAACGACGGCGCCGCCGACCCGGGCGCCGTGGCCGGTTTCCAGCCCTACGGT
CAGGGCGTCGTCTTCGGCTCCCCGGCGGGACACGTGCAGCAGATGCAGTACCAGCAGGGCCTTATGGGTAGGGCC
ACTCCGCCCATGAACTACGGCTTCCCGCCGCTGCAGCCCGGCTACGGGGCATACGGCGGGCCGGCCTCGGCGGTG
GATCAGTTTCGGCAGCAGAACATGCCCAACGGGAGCCCCATACAGCCGTCTTCGTCGTCGCCCCAGGTTCCCCAG
ATGCCGGGCGGCCAGGGACCTCCGCCGCTCGGGCCGCCGGGCTTCGGGCTATCGATGGGCGGCTCTTACGGATAC
GGCGGTTTGGTCGGAATGCCCAACATGGGCGGTTACATGCCACAGGAGCAGCAGACGAGCGCGAGGCGCGGCCGT
AGATGA
Transcript >Ophcf2|06480
ATGGCTCCTGGCTATTCCCCGCGCCGCTCCGCCCCCCAAACTCGCTCCCAATCGCCCTCCGCCGAAGCCAGAGCT
CATTACGCCCTCAGTCACAACGGCATCATGGCCACCAACTCGCGATCCGGGGCTGGTTCTCCGTCGCACGAAATG
TCCGGCTCGGGCCGGCCATACCCAAAGCGAACCAGAGAGATTCAGCAGGAGGGCAAGTCGGCAGCGCCCCTCAAC
ATGTGGAGCGGCCCTCCCACCAGCGGCAACTCGACCCCCCTCCGCGAGAACATACCCGAATCCCCCACAGACGGC
TTCCCCGACTTTGCCCAGCTGCCGACGCCCGAGAGCCTGCCGCCGACCAGGAGGGCCCGCGCCGGCACCGTCCCC
TCCCGCTTCTCCCCCGGCGGCCCGCTCAACGTCCAGAACCTGGCCCCAAAGTCGGCCCGTGCCACCCCGTCCGCC
CCGACGCCCTTCAACAAGTCCCAGTCGCCCTCCCCGAGCCTCGACCCGCCCGAGGGCTCGTCCTCGTCCGGCTCG
GCCCTCCTGTCCCGCCTCCGGGCGGGCTCCATGCCCCAGCGCAGCCCCTTCGCCCCCGCGCCCGCCACCGCCGGC
TCGCCTTTCGGCCCTTCCATCTTCAGCACCGGCTGGAACCCGGCTGGCGTCGGCCGTGAGCGGGGCTCCACCCTC
GCCAGCATCGCCAGCGTCGGCTCCAACGGGCCCAGCTCCCCGGCCCAGTCCCAGTTCTCCTCCAAGGAGGCCGTT
GGCGAGTCCGACGTGCACATGCGAACCCTCGACTACCTCGGTCTGGCCGAGACGCCGCAGCCGCCTCCAAGGGCC
CAGCTCGCCACGCCCTACATGGCCAACTTTGATTACACCAAGCAGTCGAGCCGCTTCCGCTCCTATTCCGTCAAT
AACAAGGACAAGTATGCCGACGAAGACGACGACGACGTCGACGACTACGACGTCGACGCCATGCACCACCCGGAC
AGCCAGTACGTCGCCGCCGCGCTGCAAGACCAGCTGGCCGCCACCAATGTCGCCATCCACAACCATAACCTGGCT
GTTCAGGCCTTTGCCAATCAGGCTTCGGTGACGCGGCCCCGCGCCCGCACCGCCGGCGTCCTCGACTCGCCTGGC
AGCCGCCTGATGAGGACGTACCTCACGGGCGGCACCGCCGTCGCCGCCAACCCCACGGCCGAGTTGCGCGAGGAC
GAGTACGACGACCTGCCCCAGGCCGTCGTGGCCGGCATGAACCTCGGCAGGTCCAGCAGCCGCAACGCCGGCGGC
ATGCTGGGCGCCGAGGATCAGGGGCTCGAGGGCCCGACGAGCGCCCTGTGGCTGGGCGGCATGCCCACGTCGACG
ACGACATCCACGCTCATCGAGATGTTCAAGGCCCACGGCCCCATCGTCTCGGCCCGCGTCCTGACGCACAAGAAC
TGCGGCTTCGTCAACTTCGAGAGGGTCGAGAGCGCCATGTCGGCCAGGTCCAGCCTCAACGGCAAGGAGATCTTC
CCCGGCGCCGGGCCCATCCGCATCAACTTCGCCAAGCCCCCCTCGTCGGCCAACACGCCCGGCCACGACGGCGCC
GTCCCGTCCCCCAGCCCGGACCCCTTTTCCAGGTCTCAGGACGCCGGCGCGGCCTCGGCGGCGGCGGCGGCGGCG
GCGGGCGCAGACGGCGTCCACCCGGCCTCGGCTGCGGCTGCGGCGGGCAAGACGACACCCGCCGTGCCGCCCTTG
CGCGACATGATGACGGACATTGTCGACATCGTCGGCCAGTTCGGGGCCTCGGACGACGACAAGGCGGTCATCTCG
CGCAGCGTGCAGTCGGCCATCCAGTACAAAGGCTTCGTCGAGGAGATTCCGGCCATCCGCGAACCCACGCACACG
CGGGTCCACGACGCGCCCAGGCTGAGAGACATTCGCAAGCGCATCGACAACCAGCTCTTGTCCCAGGCCGAGATC
GAGGACGTGGCCATGGAGATGCTGCCCGAGATCGCCGAGCTCTCGTCCGACTACCTGGGCAACACGGTGGTGCAG
AAGCTGTTCGAGCACTGCGGCGACCCCGTCAGGGACGCCATGCTGGCCGAGATCGGGCCTCACATGGCCGAGATC
GGCATCCACAAGAACGGCACGTGGGCGGCGCAGAAGATCATTGACGTGTGCAAGACGAGCGGGCAGATGTCGGTC
ATCGTCGACAACCTGCGGCCGTACACGGTGCCCCTGTTCCTGGACCAGTACGGCAACTACGTGCTTCAGGGGTGC
CTCAAGTTCGGCACGCCCTACAACGAGTTCATCTTCGAGACGATGCTGAGCAGGATGTGGGAAGTGGCCCAGGGC
CGCTTCGGCGCCCGCGCCATGAGGGCCTGTCTCGAGAGCCACCACGCCAGCAAGAACCAGCAGCGGATGCTGGCG
GCTGCCATCGCCCTCCATAGCGTCCAGCTGGCGACCAACGCCAACGGCGCCCTGCTCCTGACCTGGTTCCTCGAC
ACGTGCACCTTTCCCCAGCGGCGCACCGTCCTGTCGCCGCGCCTGGTGCCGTGTCTCGTCCACCTGTGCACACAC
AAGGTGGCCTACCTGACGGTGCTCAAGGTCATCAACCAGAAGGCGGAGCACAACGCGCGCGACACCATACTCAAG
GCCCTCTTCTTCACCCCAAACGATCAGGTGCTCGAGGCTATCCTGTCCGATCACGCATGCGGTTCGACGCTCATC
TTCAAGGTGCTTACCACCCCCTTTTTCGACGAGAGCATCCGTGCCCGCGTCGTCGAAAATGTCAAGAATGTGCTC
GTCAGGATCAAGGCCCAACCCGGTCAGGGCTACAAGCGTCTGATGGACGAGGTCGGACTTTCCACCAGGACGGCT
GGGCCGGGCGGCCGCGAAGGGGGTGGCAACGGCCACACCGACCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGCAGCAACAGCAGCAACAACAACAGCAGCAGCAGCAGCAGAGGCAGCGGCCGGCCTCGAGGCACGCCGGCGTC
AACGGTGGTCACCACGGGCAGCAGGCCCACGGCGGCGGTGGCAAGCCCTTCTTCGCCTCCATGAACCCCGGCTTC
GACGTGGGCTACGGGCCTCCTAGGAACGACGGCGCCGCCGACCCGGGCGCCGTGGCCGGTTTCCAGCCCTACGGT
CAGGGCGTCGTCTTCGGCTCCCCGGCGGGACACGTGCAGCAGATGCAGTACCAGCAGGGCCTTATGGGTAGGGCC
ACTCCGCCCATGAACTACGGCTTCCCGCCGCTGCAGCCCGGCTACGGGGCATACGGCGGGCCGGCCTCGGCGGTG
GATCAGTTTCGGCAGCAGAACATGCCCAACGGGAGCCCCATACAGCCGTCTTCGTCGTCGCCCCAGGTTCCCCAG
ATGCCGGGCGGCCAGGGACCTCCGCCGCTCGGGCCGCCGGGCTTCGGGCTATCGATGGGCGGCTCTTACGGATAC
GGCGGTTTGGTCGGAATGCCCAACATGGGCGGTTACATGCCACAGGAGCAGCAGACGAGCGCGAGGCGCGGCCGT
AGATGA
Gene >Ophcf2|06480
ATGGCTCCTGGCTATTCCCCGCGCCGCTCCGCCCCCCAAACTCGCTCCCAATCGCCCTCCGCCGAAGCCAGAGCT
CATTACGCCCTCAGTCACAACGGCATCATGGCCACCAACTCGCGATCCGGGGCTGGTTCTCCGTCGCACGAAATG
TCCGGCTCGGGCCGGCCATACCCAAAGCGGTTCGCCCAATTCCCCCGGCCCCCTTTTTACCTCTCTTCCACGGCC
CGAATCCGACTGACCTCGGACAGAACCAGAGAGATTCAGCAGGAGGGCAAGTCGGCAGCGCCCCTCAACATGTGG
AGCGGCCCTCCCACCAGCGGCAACTCGACCCCCCTCCGCGAGAACATACCCGAATCCCCCACAGACGGCTTCCCC
GACTTTGCCCAGCTGCCGACGCCCGAGAGCCTGCCGCCGACCAGGAGGGCCCGCGCCGGCACCGTCCCCTCCCGC
TTCTCCCCCGGCGGCCCGCTCAACGTCCAGAACCTGGCCCCAAAGTCGGCCCGTGCCACCCCGTCCGCCCCGACG
CCCTTCAACAAGTCCCAGTCGCCCTCCCCGAGCCTCGACCCGCCCGAGGGCTCGTCCTCGTCCGGCTCGGCCCTC
CTGTCCCGCCTCCGGGCGGGCTCCATGCCCCAGCGCAGCCCCTTCGCCCCCGCGCCCGCCACCGCCGGCTCGCCT
TTCGGCCCTTCCATCTTCAGCACCGGCTGGAACCCGGCTGGCGTCGGCCGTGAGCGGGGCTCCACCCTCGCCAGC
ATCGCCAGCGTCGGCTCCAACGGGCCCAGCTCCCCGGCCCAGTCCCAGTTCTCCTCCAAGGAGGCCGTTGGCGAG
TCCGACGTGCACATGCGAACCCTCGACTACCTCGGTCTGGCCGAGACGCCGCAGCCGCCTCCAAGGGCCCAGCTC
GCCACGCCCTACATGGCCAACTTTGATTACACCAAGCAGTCGAGCCGCTTCCGCTCCTATTCCGTCAATAACAAG
GACAAGTATGCCGACGAAGACGACGACGACGTCGACGACTACGACGTCGACGCCATGCACCACCCGGACAGCCAG
TACGTCGCCGCCGCGCTGCAAGACCAGCTGGCCGCCACCAATGTCGCCATCCACAACCATAACCTGGCTGTTCAG
GCCTTTGCCAATCAGGCTTCGGTGACGCGGCCCCGCGCCCGCACCGCCGGCGTCCTCGACTCGCCTGGCAGCCGC
CTGATGAGGACGTACCTCACGGGCGGCACCGCCGTCGCCGCCAACCCCACGGCCGAGTTGCGCGAGGACGAGTAC
GACGACCTGCCCCAGGCCGTCGTGGCCGGCATGAACCTCGGCAGGTCCAGCAGCCGCAACGCCGGCGGCATGCTG
GGCGCCGAGGATCAGGGGCTCGAGGGCCCGACGAGCGCCCTGTGGCTGGGCGGCATGCCCACGTCGACGACGACA
TCCACGCTCATCGAGATGTTCAAGGCCCACGGCCCCATCGTCTCGGCCCGCGTCCTGACGCACAAGAACTGCGGC
TTCGTCAACTTCGAGAGGGTCGAGAGCGCCATGTCGGCCAGGTCCAGCCTCAACGGCAAGGAGATCTTCCCCGGC
GCCGGGCCCATCCGCATCAACTTCGCCAAGCCCCCCTCGTCGGCCAACACGCCCGGCCACGACGGCGCCGTCCCG
TCCCCCAGCCCGGACCCCTTTTCCAGGTCTCAGGACGCCGGCGCGGCCTCGGCGGCGGCGGCGGCGGCGGCGGGC
GCAGACGGCGTCCACCCGGCCTCGGCTGCGGCTGCGGCGGGCAAGACGACACCCGCCGTGCCGCCCTTGCGCGAC
ATGATGACGGACATTGTCGACATCGTCGGCCAGTTCGGGGCCTCGGACGACGACAAGGCGGTCATCTCGCGCAGC
GTGCAGTCGGCCATCCAGTACAAAGGCTTCGTCGAGGAGATTCCGGCCATCCGCGAACCCACGCACACGCGGGTC
CACGACGCGCCCAGGCTGAGAGACATTCGCAAGCGCATCGACAACCAGCTCTTGTCCCAGGCCGAGATCGAGGAC
GTGGCCATGGAGATGCTGCCCGAGATCGCCGAGCTCTCGTCCGACTACCTGGGCAACACGGTGGTGCAGAAGCTG
TTCGAGCACTGCGGCGACCCCGTCAGGGACGCCATGCTGGCCGAGATCGGGCCTCACATGGCCGAGATCGGCATC
CACAAGAACGGCACGTGGGCGGCGCAGAAGATCATTGACGTGTGCAAGACGAGCGGGCAGATGTCGGTCATCGTC
GACAACCTGCGGCCGTACACGGTGCCCCTGTTCCTGGACCAGTACGGCAACTACGTGCTTCAGGGGTGCCTCAAG
TTCGGCACGCCCTACAACGAGTTCATCTTCGAGACGATGCTGAGCAGGATGTGGGAAGTGGCCCAGGGCCGCTTC
GGCGCCCGCGCCATGAGGGCCTGTCTCGAGAGCCACCACGCCAGCAAGAACCAGCAGCGGATGCTGGCGGCTGCC
ATCGCCCTCCATAGCGTCCAGCTGGCGACCAACGCCAACGGCGCCCTGCTCCTGACCTGGTTCCTCGACACGTGC
ACCTTTCCCCAGCGGCGCACCGTCCTGTCGCCGCGCCTGGTGCCGTGTCTCGTCCACCTGTGCACACACAAGGTG
GCCTACCTGACGGTGCTCAAGGTCATCAACCAGAAGGCGGAGCACAACGCGCGCGACACCATACTCAAGGCCCTC
TTCTTCACCCCAAACGATCAGGTGCTCGAGGCTATCCTGTCCGATCACGCATGCGGTTCGACGCTCATCTTCAAG
GTGCTTACCACCCCCTTTTTCGACGAGAGCATCCGTGCCCGCGTCGTCGAAAATGTCAAGAATGTGCTCGTCAGG
ATCAAGGCCCAACCCGGTCAGGGCTACAAGCGTCTGATGGACGAGGTCGGACTTTCCACCAGGACGGCTGGGCCG
GGCGGCCGCGAAGGGGGTGGCAACGGCCACACCGACCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAG
CAACAGCAGCAACAACAACAGCAGCAGCAGCAGCAGAGGCAGCGGCCGGCCTCGAGGCACGCCGGCGTCAACGGT
GGTCACCACGGGCAGCAGGCCCACGGCGGCGGTGGCAAGCCCTTCTTCGCCTCCATGAACCCCGGCTTCGACGTG
GGCTACGGGCCTCCTAGGAACGACGGCGCCGCCGACCCGGGCGCCGTGGCCGGTTTCCAGCCCTACGGTCAGGGC
GTCGTCTTCGGCTCCCCGGCGGGACACGTGCAGCAGATGCAGTACCAGCAGGGCCTTATGGGTAGGGCCACTCCG
CCCATGAACTACGGCTTCCCGCCGCTGCAGCCCGGCTACGGGGCATACGGCGGGCCGGCCTCGGCGGTGGATCAG
TTTCGGCAGCAGAACATGCCCAACGGGAGCCCCATACAGCCGTCTTCGTCGTCGCCCCAGGTTCCCCAGATGCCG
GGCGGCCAGGGACCTCCGCCGCTCGGGCCGCCGGGCTTCGGGCTATCGATGGGCGGCTCTTACGGATACGGCGGT
TTGGTCGGAATGCCCAACATGGGCGGTTACATGCCACAGGAGCAGCAGACGAGCGCGAGGCGCGGCCGTGTACGT
TTTTGTCCTCGAAATGAGCCGTCTCGTTGGCTAGAATCGTGAGCTGACTTGGCGGTTAGAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail