Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06478
Gene name
Locationscaffold_08:203819..205306
Strand+
Gene length (bp)1487
Transcript length (bp)1260
Coding sequence length (bp)1260
Protein length (aa) 420

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00557 Peptidase_M24 Metallopeptidase family M24 7.1E-07 20 159

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6446 0.5905 0.164 0.0353 0.0462 0.026 0.2088 0.0215 0.3021 0.0023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2010
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4523
Ophiocordyceps australis map64 (Brazil) OphauB2|4268
Ophiocordyceps camponoti-floridani Ophcf2|06478 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5687
Ophiocordyceps kimflemingae Ophio5|5036
Ophiocordyceps subramaniannii Hirsu2|2259

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06478
MSDDKEPIDYSLNNPDTLTKYKTAGQIAEKVLAAVADLCVPGEKIVDICQKGDKLIEEEIAKVYRGKKVAKGFSH
PTTVSPASYVTPYTPLTSDEAEAAVEVQAGEPIKIQLGAQIDGFGAIVCDTLLAAPKDKAAEQVTGRQADLMLAT
YYANELLLRLMLPPGLLAQGTDEEKAKAAAQKPPTQAKMTSMLEKVCESYGCHLVESTTSWLFDRNEIEGPKKIV
LAPAEGTKGEGTPATQEVWGVEMGVSLGSGKVKMLQQRATLHRRTTQTYGLKRPTSRKILSEVQKKFGTFPFSLR
QLDDERDAKSGVVECVRGNVFRQYELVADKDNAPVARLLTTIVITKNGITKLGGPPALDVSKYKSDKKITDEEVL
KMLEQPLSRNTGKKKSKSKKKKKPAKKEAAGGAESDENSDASDD*
Coding >Ophcf2|06478
ATGTCGGATGACAAGGAGCCTATTGACTACTCGCTCAACAATCCCGATACTCTGACCAAGTACAAGACGGCTGGT
CAGATTGCGGAAAAGGTTCTCGCTGCCGTGGCCGACCTCTGCGTGCCGGGCGAGAAAATCGTCGACATCTGCCAA
AAGGGCGACAAGTTGATTGAGGAGGAGATTGCCAAGGTCTATCGCGGCAAAAAGGTGGCCAAAGGTTTCTCTCAC
CCCACCACCGTCTCGCCCGCGTCATATGTCACCCCTTACACCCCCCTGACGTCGGACGAGGCCGAGGCCGCTGTC
GAGGTGCAAGCCGGTGAGCCCATCAAGATCCAGCTCGGGGCCCAGATTGATGGCTTCGGCGCCATCGTCTGCGAC
ACCCTCCTGGCCGCGCCCAAGGACAAGGCGGCCGAGCAGGTGACGGGCCGACAGGCCGACCTGATGCTGGCCACG
TACTATGCCAACGAGCTGCTCCTGCGCCTCATGCTGCCCCCGGGTCTGCTGGCCCAGGGCACGGACGAGGAAAAG
GCCAAGGCGGCGGCGCAGAAGCCACCGACGCAGGCCAAGATGACGAGCATGCTGGAAAAGGTGTGCGAGAGCTAC
GGCTGCCATCTCGTCGAGAGCACCACCTCGTGGCTCTTTGACCGCAACGAGATCGAGGGCCCCAAGAAGATTGTG
CTGGCGCCCGCCGAGGGCACCAAGGGCGAGGGCACGCCCGCCACCCAGGAGGTGTGGGGTGTCGAGATGGGCGTG
AGCCTGGGATCCGGCAAGGTCAAGATGTTGCAGCAGCGGGCGACGCTTCACCGGCGCACGACGCAGACGTACGGA
CTCAAGCGGCCCACGTCGCGCAAGATCCTGTCCGAGGTGCAGAAGAAGTTTGGCACCTTTCCCTTTAGCCTGCGC
CAGCTCGACGACGAGCGCGATGCAAAGTCGGGCGTGGTCGAGTGCGTGCGAGGCAACGTCTTCCGCCAGTATGAG
CTGGTGGCCGACAAGGACAATGCTCCCGTCGCCAGACTCCTGACGACGATTGTCATCACCAAGAACGGCATCACC
AAGCTGGGCGGCCCGCCCGCGCTTGACGTGAGCAAGTACAAGTCGGACAAGAAGATTACGGATGAGGAGGTGCTC
AAGATGCTGGAGCAGCCGCTGTCGAGGAACACGGGCAAGAAGAAGAGCAAGAGCAAGAAGAAGAAGAAGCCGGCC
AAGAAGGAGGCAGCAGGCGGGGCAGAGTCGGACGAGAACTCGGACGCAAGTGACGACTAG
Transcript >Ophcf2|06478
ATGTCGGATGACAAGGAGCCTATTGACTACTCGCTCAACAATCCCGATACTCTGACCAAGTACAAGACGGCTGGT
CAGATTGCGGAAAAGGTTCTCGCTGCCGTGGCCGACCTCTGCGTGCCGGGCGAGAAAATCGTCGACATCTGCCAA
AAGGGCGACAAGTTGATTGAGGAGGAGATTGCCAAGGTCTATCGCGGCAAAAAGGTGGCCAAAGGTTTCTCTCAC
CCCACCACCGTCTCGCCCGCGTCATATGTCACCCCTTACACCCCCCTGACGTCGGACGAGGCCGAGGCCGCTGTC
GAGGTGCAAGCCGGTGAGCCCATCAAGATCCAGCTCGGGGCCCAGATTGATGGCTTCGGCGCCATCGTCTGCGAC
ACCCTCCTGGCCGCGCCCAAGGACAAGGCGGCCGAGCAGGTGACGGGCCGACAGGCCGACCTGATGCTGGCCACG
TACTATGCCAACGAGCTGCTCCTGCGCCTCATGCTGCCCCCGGGTCTGCTGGCCCAGGGCACGGACGAGGAAAAG
GCCAAGGCGGCGGCGCAGAAGCCACCGACGCAGGCCAAGATGACGAGCATGCTGGAAAAGGTGTGCGAGAGCTAC
GGCTGCCATCTCGTCGAGAGCACCACCTCGTGGCTCTTTGACCGCAACGAGATCGAGGGCCCCAAGAAGATTGTG
CTGGCGCCCGCCGAGGGCACCAAGGGCGAGGGCACGCCCGCCACCCAGGAGGTGTGGGGTGTCGAGATGGGCGTG
AGCCTGGGATCCGGCAAGGTCAAGATGTTGCAGCAGCGGGCGACGCTTCACCGGCGCACGACGCAGACGTACGGA
CTCAAGCGGCCCACGTCGCGCAAGATCCTGTCCGAGGTGCAGAAGAAGTTTGGCACCTTTCCCTTTAGCCTGCGC
CAGCTCGACGACGAGCGCGATGCAAAGTCGGGCGTGGTCGAGTGCGTGCGAGGCAACGTCTTCCGCCAGTATGAG
CTGGTGGCCGACAAGGACAATGCTCCCGTCGCCAGACTCCTGACGACGATTGTCATCACCAAGAACGGCATCACC
AAGCTGGGCGGCCCGCCCGCGCTTGACGTGAGCAAGTACAAGTCGGACAAGAAGATTACGGATGAGGAGGTGCTC
AAGATGCTGGAGCAGCCGCTGTCGAGGAACACGGGCAAGAAGAAGAGCAAGAGCAAGAAGAAGAAGAAGCCGGCC
AAGAAGGAGGCAGCAGGCGGGGCAGAGTCGGACGAGAACTCGGACGCAAGTGACGACTAG
Gene >Ophcf2|06478
ATGTCGGATGACAAGGAGCCTATTGGTGAGAGATTCATCCCTCTTGAGAAATACGCAGCGCGCACAACTACCCCT
CCTTCTTCCCCTCCCTCGCCTTGTATTGTATGTATGTAGGTCGCTGATAATGTGCGCCCACAGACTACTCGCTCA
ACAATCCCGATACTCTGACCAAGTACAAGACGGCTGGTCAGATTGCGGAAAAGGTTCTCGCTGCCGTGGCCGACC
TCTGCGTGCCGGGCGAGAAAATCGTCGACATCTGCCAAAAGGGCGACAAGTTGATTGAGGAGGAGATTGCCAAGG
TCTATCGCGGCAAAAAGGTGGCCAAAGGTGAGCTCAGGAAGCTTCGCGATAGCTCGGAACAGCTCTGCTGCTAAC
TGCAGACAGGTTTCTCTCACCCCACCACCGTCTCGCCCGCGTCATATGTCACCCCTTACACCCCCCTGACGTCGG
ACGAGGCCGAGGCCGCTGTCGAGGTGCAAGCCGGTGAGCCCATCAAGATCCAGCTCGGGGCCCAGATTGATGGCT
TCGGCGCCATCGTCTGCGACACCCTCCTGGCCGCGCCCAAGGACAAGGCGGCCGAGCAGGTGACGGGCCGACAGG
CCGACCTGATGCTGGCCACGTACTATGCCAACGAGCTGCTCCTGCGCCTCATGCTGCCCCCGGGTCTGCTGGCCC
AGGGCACGGACGAGGAAAAGGCCAAGGCGGCGGCGCAGAAGCCACCGACGCAGGCCAAGATGACGAGCATGCTGG
AAAAGGTGTGCGAGAGCTACGGCTGCCATCTCGTCGAGAGCACCACCTCGTGGCTCTTTGACCGCAACGAGATCG
AGGGCCCCAAGAAGATTGTGCTGGCGCCCGCCGAGGGCACCAAGGGCGAGGGCACGCCCGCCACCCAGGAGGTGT
GGGGTGTCGAGATGGGCGTGAGCCTGGGATCCGGCAAGGTCAAGATGTTGCAGCAGCGGGCGACGCTTCACCGGC
GCACGACGCAGACGTACGGACTCAAGCGGCCCACGTCGCGCAAGATCCTGTCCGAGGTGCAGAAGAAGTTTGGCA
CCTTTCCCTTTAGCCTGCGCCAGCTCGACGACGAGCGCGATGCAAAGTCGGGCGTGGTCGAGTGCGTGCGAGGCA
ACGTCTTCCGCCAGTATGAGCTGGTGGCCGACAAGGACAATGCTCCCGTCGCCAGACTCCTGACGACGATTGGTG
AGTTGCAGTGAGTACGTGTCGCGATGGATGGATGCTGACGAGGGTATCCGACAGTCATCACCAAGAACGGCATCA
CCAAGCTGGGCGGCCCGCCCGCGCTTGACGTGAGCAAGTACAAGTCGGACAAGAAGATTACGGATGAGGAGGTGC
TCAAGATGCTGGAGCAGCCGCTGTCGAGGAACACGGGCAAGAAGAAGAGCAAGAGCAAGAAGAAGAAGAAGCCGG
CCAAGAAGGAGGCAGCAGGCGGGGCAGAGTCGGACGAGAACTCGGACGCAAGTGACGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail