Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06476
Gene name
Locationscaffold_08:195822..200317
Strand+
Gene length (bp)4495
Transcript length (bp)4344
Coding sequence length (bp)4344
Protein length (aa) 1448

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20168 PDS5 Sister chromatid cohesion protein PDS5 protein 0.0E+00 67 1244

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1649 0.9022 0.2964 0.0396 0.0604 0.0582 0.0209 0.0126 0.0308 0.0026

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3604
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4521
Ophiocordyceps australis map64 (Brazil) OphauB2|6158
Ophiocordyceps camponoti-floridani Ophcf2|06476 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5689
Ophiocordyceps kimflemingae Ophio5|8355
Ophiocordyceps subramaniannii Hirsu2|695

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06476
MPRRRARRREPTEDAEEDDEQVHNETAGPRTSGVDTQLARFGSSGLRSLRFDEELSWRPAKPIPSATLVARLEKL
SKELADFDQGEVELDSLRAVAGHLAHRNLLQHKDRGVKAYTACCLVDMLRLFVPDAPFTDDQLKMMFSLFVKDIL
PALHDSTNPYYSQHKYVLVSLTDVKSILLISDIHGADDLMLRLFNSAFDGVSASAKASTGEQVAQDVEILLGEML
MELIDESPGSIPATVIDAIISQFLRAAPPGSGSGGRHKDVSDKQSTLLRKTEPPAYVMAKSICNSCADKMSRYVS
QYFSDVILNASGFATKANNYRQGDDSDEEDANAGPSDADLKSLRQAHLLIRELWRAAPEILQNVVPQLDAELSAD
NVHLRLIATETFGDMISGIGAAGPPPMPTLDPTAYPQLRLMDETPPPEPTEVNVLKKPCSPQSFAQTHAATYRNF
IGRKNDKAGAIRAAWVTAVGYIVSTSAGGIGLSREEESELVRGLGEKLNDSEEKVRLAAVKAIELFGFRDVVSKL
GVVGGVEKEGSILASLADRCRDRKPAVRVDAMVLLGKLWAVGAGEMADGQDAVTACLWGVPSRIINAFYANDPDL
NILLDRVMFECLVPLKYPSIKKSAKSQTKGAADQDRIRAERILLMLKSLDAAAQKAFFAMQARQPQFAQGVAIFI
QQCEAYNGGVVDGNEDKVKASLAKTLQWLGTSFPDPLKVRSDLQKFAKLNDRRSYQLVKYAIESESDFKTVRRAI
HELITKIQAGSASGCLDTLIPLLYRSSCLMFNRSNLATIMDYSKSDKDGFAAVAHQVLNDISQRNPDIFKAHVGE
LHRDITEQAPTDKRTNDPAVADILKAYSSYSKRYPRDIDCSKAFVQTLVNYALYGSPPKSGKYAVNILLAKDDDR
SKVTATNLLRSAVKDLNYGTPHFLTRLATVSQLERLAPSVAADEDEVIDDLTINKMLRQVRTAAEPDSDPTWVHD
VDMDQELQAKCLSLRILVNRAMAAAEEPDSEERVKPVFKLLRTLVVAEGEFCKTQDTPAHHKKRLRLLAGLLTLK
LCTVKAYDEQLEPLSFNKLAELVQDSELQVRRRFMEKLQNYLTRGKLRARFHTILFLVAFEPVTELKSRVETWIR
SRARYYEEKKQQIMEAIMGRLIPLLAHHPDYTSHVDDLADFANYFLFYLGSVATEGNISLIYKYAERVKQTRDAL
SPDGSDNLYVLSDLAQTIIRKYQERRNWSFQAWPGKVGLPTGLYVGLPSSEMAQQIAKKQYIPDELDERLDDLMR
AMDRKKKRKSMNDASEPPAKRTKGLVKTTTRDRTEAKSKSGPKKASKPKTTPRAKKASSPAVPASERRRSSRVHK
VSDYKERDDADDEEEMLDGVAVWDYEGEGVSSELDAGRDSDDGDEGPARDDEGSESESKSPPTTSRRSGKSAPAR
SKGRAVGGGQKKRSPRRHQGLF*
Coding >Ophcf2|06476
ATGCCGCGTCGTCGCGCGCGTCGCCGGGAGCCGACCGAGGATGCGGAGGAGGACGACGAACAGGTTCACAATGAA
ACTGCCGGGCCTCGAACTTCTGGGGTAGATACGCAGCTCGCGCGGTTTGGCAGTTCGGGGCTGCGAAGTTTGCGC
TTCGACGAGGAGCTCTCGTGGAGGCCGGCCAAGCCTATTCCCAGCGCTACCCTCGTAGCCCGCCTCGAGAAGCTG
TCCAAGGAACTGGCCGACTTTGACCAGGGCGAGGTTGAGCTTGACTCTCTACGCGCTGTTGCAGGTCATCTCGCC
CATCGCAACCTGCTGCAGCACAAGGATCGCGGTGTTAAGGCGTACACGGCCTGCTGCCTGGTTGACATGCTCCGC
CTCTTCGTCCCGGACGCTCCCTTTACCGATGATCAGCTCAAGATGATGTTTTCGCTCTTCGTCAAGGATATCCTG
CCGGCCCTGCACGACTCGACCAATCCGTACTACAGCCAGCATAAATACGTTCTCGTCTCCTTGACCGACGTCAAG
AGCATCCTGCTCATCTCTGATATCCATGGCGCCGATGATCTCATGTTGCGCCTATTCAACTCGGCCTTTGACGGC
GTCTCGGCCAGCGCCAAGGCCTCGACCGGCGAGCAGGTCGCACAAGACGTCGAGATCCTGCTGGGCGAGATGCTC
ATGGAGCTCATAGATGAGTCTCCTGGTAGTATTCCGGCCACGGTCATCGACGCCATCATCAGCCAATTCCTACGC
GCCGCACCGCCGGGCAGTGGCAGCGGCGGTCGTCACAAGGACGTCAGCGACAAGCAGTCGACGCTCCTCCGCAAG
ACAGAACCTCCCGCATACGTCATGGCCAAGAGCATCTGCAACAGCTGTGCCGACAAGATGTCGCGCTACGTGAGC
CAATACTTTAGCGACGTCATCCTCAACGCCTCGGGGTTTGCCACCAAGGCCAACAACTACCGTCAAGGCGACGAC
TCGGACGAAGAAGACGCCAATGCCGGCCCATCAGACGCGGATCTCAAGAGCCTCCGTCAGGCGCATCTGCTTATA
CGCGAGCTCTGGCGCGCCGCCCCCGAGATCCTACAAAACGTGGTACCTCAGCTGGACGCGGAGCTGTCTGCGGAC
AACGTCCACCTGCGACTGATAGCGACGGAAACGTTTGGCGACATGATTTCCGGCATCGGCGCCGCGGGTCCTCCG
CCGATGCCGACGCTCGATCCGACAGCATACCCGCAGCTGCGCCTGATGGACGAGACGCCTCCGCCAGAGCCTACC
GAAGTCAACGTACTGAAGAAGCCCTGCTCGCCGCAGTCGTTCGCCCAGACACACGCCGCGACGTACCGCAACTTC
ATCGGGCGCAAGAACGACAAGGCGGGTGCGATTCGAGCGGCTTGGGTCACAGCCGTGGGCTACATCGTCTCGACG
TCGGCCGGCGGCATCGGTCTCAGCCGTGAGGAGGAGAGCGAGCTCGTCAGGGGGCTCGGCGAGAAGCTCAACGAC
AGCGAGGAAAAGGTGCGACTCGCGGCTGTCAAGGCCATAGAGCTCTTTGGCTTCCGCGACGTCGTCTCCAAGCTG
GGCGTCGTCGGCGGCGTGGAAAAGGAGGGCTCCATCCTGGCCAGCCTCGCGGACCGCTGTCGCGACAGGAAGCCG
GCTGTACGCGTCGACGCCATGGTTCTCCTCGGGAAGCTGTGGGCGGTCGGTGCCGGTGAGATGGCTGACGGACAG
GATGCTGTCACGGCCTGTCTCTGGGGCGTGCCGTCGCGCATCATCAACGCCTTCTATGCCAACGATCCCGATCTC
AACATCCTGCTCGACAGGGTCATGTTCGAGTGCCTGGTTCCTCTCAAGTACCCGTCTATCAAGAAGTCGGCCAAG
TCGCAGACCAAGGGCGCTGCCGACCAGGACAGGATCCGGGCGGAGCGCATCCTGCTCATGCTCAAGTCGCTGGAC
GCGGCCGCGCAAAAGGCCTTCTTCGCCATGCAGGCGCGGCAGCCGCAGTTTGCCCAGGGCGTCGCCATCTTCATC
CAGCAGTGTGAGGCCTACAACGGGGGCGTCGTGGACGGTAACGAGGACAAGGTCAAGGCCAGCCTGGCCAAGACG
CTGCAGTGGCTCGGCACCTCGTTCCCCGATCCGCTCAAGGTGCGGTCTGATCTGCAGAAGTTTGCAAAGCTCAAC
GATCGCCGCAGCTACCAGCTGGTCAAGTACGCCATTGAGTCCGAGAGCGACTTCAAGACGGTCCGGAGGGCCATC
CACGAGCTCATCACTAAGATCCAGGCGGGATCGGCCTCGGGCTGTTTGGATACGCTGATTCCCCTGCTCTACCGG
TCCAGCTGCCTCATGTTCAACCGCAGCAACCTGGCGACCATCATGGACTACTCCAAGAGCGATAAGGACGGCTTC
GCCGCCGTTGCCCATCAAGTCCTCAACGACATCTCGCAGCGGAATCCCGACATCTTCAAGGCCCACGTCGGCGAG
CTGCACAGGGACATCACCGAGCAGGCGCCTACGGACAAGAGGACCAACGACCCGGCCGTGGCCGACATTCTCAAG
GCCTACTCGTCCTACTCGAAACGTTACCCGCGCGACATCGACTGCAGTAAAGCCTTCGTCCAGACGCTCGTCAAC
TACGCCCTCTACGGATCACCTCCCAAGTCTGGCAAGTACGCCGTCAACATCCTCCTCGCCAAGGACGACGATCGG
AGCAAGGTCACGGCCACGAACCTCTTGAGGAGCGCAGTCAAGGACCTGAACTACGGCACGCCGCATTTCCTTACC
AGACTGGCTACCGTCAGCCAGCTCGAGCGCCTCGCGCCCTCCGTCGCCGCCGACGAGGATGAAGTCATAGACGAT
CTGACCATCAACAAGATGCTGCGCCAAGTGCGGACCGCGGCCGAGCCAGATTCGGATCCCACCTGGGTTCATGAC
GTCGACATGGATCAGGAGCTCCAGGCCAAGTGTCTATCGCTGAGGATCCTCGTCAACCGAGCCATGGCCGCGGCC
GAGGAGCCGGACAGCGAAGAGCGGGTGAAGCCGGTCTTTAAGCTCCTCAGGACCCTCGTCGTCGCCGAGGGCGAG
TTTTGCAAGACGCAAGACACGCCGGCGCACCACAAGAAGCGGCTACGGCTACTGGCGGGCTTGTTGACACTGAAG
CTGTGCACGGTCAAGGCGTACGACGAGCAGCTGGAGCCGCTGAGCTTCAACAAGCTGGCCGAGCTCGTTCAGGAC
AGCGAGCTCCAGGTCCGACGGCGGTTCATGGAGAAGCTGCAGAACTACCTGACCCGAGGCAAGCTGCGGGCAAGA
TTCCACACCATCTTGTTCCTCGTCGCCTTTGAGCCCGTGACGGAGCTCAAGAGCAGGGTGGAAACGTGGATCCGG
TCTCGGGCTCGCTACTATGAAGAGAAGAAGCAGCAGATCATGGAGGCTATCATGGGCAGGCTGATTCCCCTCTTG
GCCCACCATCCGGACTATACCAGCCATGTCGACGATCTGGCTGACTTTGCCAACTACTTTCTCTTCTACTTGGGG
TCCGTCGCCACCGAGGGCAACATTTCTTTGATTTACAAGTACGCCGAGCGGGTCAAGCAGACGCGAGACGCTCTG
AGCCCCGACGGAAGCGACAACTTGTATGTGCTGAGCGATCTGGCGCAGACCATCATCCGGAAATACCAGGAGAGG
CGGAACTGGAGCTTCCAGGCCTGGCCGGGGAAGGTCGGGCTGCCCACGGGGCTCTACGTCGGCCTCCCTTCGAGC
GAGATGGCGCAGCAGATTGCCAAGAAGCAGTACATCCCGGATGAGCTGGACGAGAGGCTCGACGACCTGATGAGG
GCCATGGACCGCAAAAAGAAACGAAAGTCGATGAACGACGCCAGCGAGCCGCCAGCCAAACGAACCAAGGGGCTG
GTCAAAACCACCACCAGGGATCGAACCGAGGCCAAGTCCAAGTCCGGTCCGAAGAAGGCCTCCAAGCCAAAGACG
ACGCCGCGAGCAAAGAAGGCATCGTCTCCGGCTGTTCCCGCGAGCGAGCGTCGACGGAGCAGTCGCGTTCACAAG
GTGTCGGATTACAAGGAGCGAGATGACGCGGATGACGAGGAGGAGATGCTCGATGGTGTGGCCGTGTGGGACTAC
GAGGGAGAGGGTGTCTCGTCTGAATTGGATGCTGGCCGTGATTCGGATGATGGTGATGAAGGTCCGGCTCGCGAT
GACGAGGGTAGCGAATCGGAGTCCAAATCACCACCTACTACCTCACGACGAAGCGGGAAATCCGCCCCTGCTAGA
TCCAAGGGCAGGGCAGTCGGGGGGGGGCAGAAGAAGCGGTCGCCGAGGCGTCACCAAGGACTCTTCTGA
Transcript >Ophcf2|06476
ATGCCGCGTCGTCGCGCGCGTCGCCGGGAGCCGACCGAGGATGCGGAGGAGGACGACGAACAGGTTCACAATGAA
ACTGCCGGGCCTCGAACTTCTGGGGTAGATACGCAGCTCGCGCGGTTTGGCAGTTCGGGGCTGCGAAGTTTGCGC
TTCGACGAGGAGCTCTCGTGGAGGCCGGCCAAGCCTATTCCCAGCGCTACCCTCGTAGCCCGCCTCGAGAAGCTG
TCCAAGGAACTGGCCGACTTTGACCAGGGCGAGGTTGAGCTTGACTCTCTACGCGCTGTTGCAGGTCATCTCGCC
CATCGCAACCTGCTGCAGCACAAGGATCGCGGTGTTAAGGCGTACACGGCCTGCTGCCTGGTTGACATGCTCCGC
CTCTTCGTCCCGGACGCTCCCTTTACCGATGATCAGCTCAAGATGATGTTTTCGCTCTTCGTCAAGGATATCCTG
CCGGCCCTGCACGACTCGACCAATCCGTACTACAGCCAGCATAAATACGTTCTCGTCTCCTTGACCGACGTCAAG
AGCATCCTGCTCATCTCTGATATCCATGGCGCCGATGATCTCATGTTGCGCCTATTCAACTCGGCCTTTGACGGC
GTCTCGGCCAGCGCCAAGGCCTCGACCGGCGAGCAGGTCGCACAAGACGTCGAGATCCTGCTGGGCGAGATGCTC
ATGGAGCTCATAGATGAGTCTCCTGGTAGTATTCCGGCCACGGTCATCGACGCCATCATCAGCCAATTCCTACGC
GCCGCACCGCCGGGCAGTGGCAGCGGCGGTCGTCACAAGGACGTCAGCGACAAGCAGTCGACGCTCCTCCGCAAG
ACAGAACCTCCCGCATACGTCATGGCCAAGAGCATCTGCAACAGCTGTGCCGACAAGATGTCGCGCTACGTGAGC
CAATACTTTAGCGACGTCATCCTCAACGCCTCGGGGTTTGCCACCAAGGCCAACAACTACCGTCAAGGCGACGAC
TCGGACGAAGAAGACGCCAATGCCGGCCCATCAGACGCGGATCTCAAGAGCCTCCGTCAGGCGCATCTGCTTATA
CGCGAGCTCTGGCGCGCCGCCCCCGAGATCCTACAAAACGTGGTACCTCAGCTGGACGCGGAGCTGTCTGCGGAC
AACGTCCACCTGCGACTGATAGCGACGGAAACGTTTGGCGACATGATTTCCGGCATCGGCGCCGCGGGTCCTCCG
CCGATGCCGACGCTCGATCCGACAGCATACCCGCAGCTGCGCCTGATGGACGAGACGCCTCCGCCAGAGCCTACC
GAAGTCAACGTACTGAAGAAGCCCTGCTCGCCGCAGTCGTTCGCCCAGACACACGCCGCGACGTACCGCAACTTC
ATCGGGCGCAAGAACGACAAGGCGGGTGCGATTCGAGCGGCTTGGGTCACAGCCGTGGGCTACATCGTCTCGACG
TCGGCCGGCGGCATCGGTCTCAGCCGTGAGGAGGAGAGCGAGCTCGTCAGGGGGCTCGGCGAGAAGCTCAACGAC
AGCGAGGAAAAGGTGCGACTCGCGGCTGTCAAGGCCATAGAGCTCTTTGGCTTCCGCGACGTCGTCTCCAAGCTG
GGCGTCGTCGGCGGCGTGGAAAAGGAGGGCTCCATCCTGGCCAGCCTCGCGGACCGCTGTCGCGACAGGAAGCCG
GCTGTACGCGTCGACGCCATGGTTCTCCTCGGGAAGCTGTGGGCGGTCGGTGCCGGTGAGATGGCTGACGGACAG
GATGCTGTCACGGCCTGTCTCTGGGGCGTGCCGTCGCGCATCATCAACGCCTTCTATGCCAACGATCCCGATCTC
AACATCCTGCTCGACAGGGTCATGTTCGAGTGCCTGGTTCCTCTCAAGTACCCGTCTATCAAGAAGTCGGCCAAG
TCGCAGACCAAGGGCGCTGCCGACCAGGACAGGATCCGGGCGGAGCGCATCCTGCTCATGCTCAAGTCGCTGGAC
GCGGCCGCGCAAAAGGCCTTCTTCGCCATGCAGGCGCGGCAGCCGCAGTTTGCCCAGGGCGTCGCCATCTTCATC
CAGCAGTGTGAGGCCTACAACGGGGGCGTCGTGGACGGTAACGAGGACAAGGTCAAGGCCAGCCTGGCCAAGACG
CTGCAGTGGCTCGGCACCTCGTTCCCCGATCCGCTCAAGGTGCGGTCTGATCTGCAGAAGTTTGCAAAGCTCAAC
GATCGCCGCAGCTACCAGCTGGTCAAGTACGCCATTGAGTCCGAGAGCGACTTCAAGACGGTCCGGAGGGCCATC
CACGAGCTCATCACTAAGATCCAGGCGGGATCGGCCTCGGGCTGTTTGGATACGCTGATTCCCCTGCTCTACCGG
TCCAGCTGCCTCATGTTCAACCGCAGCAACCTGGCGACCATCATGGACTACTCCAAGAGCGATAAGGACGGCTTC
GCCGCCGTTGCCCATCAAGTCCTCAACGACATCTCGCAGCGGAATCCCGACATCTTCAAGGCCCACGTCGGCGAG
CTGCACAGGGACATCACCGAGCAGGCGCCTACGGACAAGAGGACCAACGACCCGGCCGTGGCCGACATTCTCAAG
GCCTACTCGTCCTACTCGAAACGTTACCCGCGCGACATCGACTGCAGTAAAGCCTTCGTCCAGACGCTCGTCAAC
TACGCCCTCTACGGATCACCTCCCAAGTCTGGCAAGTACGCCGTCAACATCCTCCTCGCCAAGGACGACGATCGG
AGCAAGGTCACGGCCACGAACCTCTTGAGGAGCGCAGTCAAGGACCTGAACTACGGCACGCCGCATTTCCTTACC
AGACTGGCTACCGTCAGCCAGCTCGAGCGCCTCGCGCCCTCCGTCGCCGCCGACGAGGATGAAGTCATAGACGAT
CTGACCATCAACAAGATGCTGCGCCAAGTGCGGACCGCGGCCGAGCCAGATTCGGATCCCACCTGGGTTCATGAC
GTCGACATGGATCAGGAGCTCCAGGCCAAGTGTCTATCGCTGAGGATCCTCGTCAACCGAGCCATGGCCGCGGCC
GAGGAGCCGGACAGCGAAGAGCGGGTGAAGCCGGTCTTTAAGCTCCTCAGGACCCTCGTCGTCGCCGAGGGCGAG
TTTTGCAAGACGCAAGACACGCCGGCGCACCACAAGAAGCGGCTACGGCTACTGGCGGGCTTGTTGACACTGAAG
CTGTGCACGGTCAAGGCGTACGACGAGCAGCTGGAGCCGCTGAGCTTCAACAAGCTGGCCGAGCTCGTTCAGGAC
AGCGAGCTCCAGGTCCGACGGCGGTTCATGGAGAAGCTGCAGAACTACCTGACCCGAGGCAAGCTGCGGGCAAGA
TTCCACACCATCTTGTTCCTCGTCGCCTTTGAGCCCGTGACGGAGCTCAAGAGCAGGGTGGAAACGTGGATCCGG
TCTCGGGCTCGCTACTATGAAGAGAAGAAGCAGCAGATCATGGAGGCTATCATGGGCAGGCTGATTCCCCTCTTG
GCCCACCATCCGGACTATACCAGCCATGTCGACGATCTGGCTGACTTTGCCAACTACTTTCTCTTCTACTTGGGG
TCCGTCGCCACCGAGGGCAACATTTCTTTGATTTACAAGTACGCCGAGCGGGTCAAGCAGACGCGAGACGCTCTG
AGCCCCGACGGAAGCGACAACTTGTATGTGCTGAGCGATCTGGCGCAGACCATCATCCGGAAATACCAGGAGAGG
CGGAACTGGAGCTTCCAGGCCTGGCCGGGGAAGGTCGGGCTGCCCACGGGGCTCTACGTCGGCCTCCCTTCGAGC
GAGATGGCGCAGCAGATTGCCAAGAAGCAGTACATCCCGGATGAGCTGGACGAGAGGCTCGACGACCTGATGAGG
GCCATGGACCGCAAAAAGAAACGAAAGTCGATGAACGACGCCAGCGAGCCGCCAGCCAAACGAACCAAGGGGCTG
GTCAAAACCACCACCAGGGATCGAACCGAGGCCAAGTCCAAGTCCGGTCCGAAGAAGGCCTCCAAGCCAAAGACG
ACGCCGCGAGCAAAGAAGGCATCGTCTCCGGCTGTTCCCGCGAGCGAGCGTCGACGGAGCAGTCGCGTTCACAAG
GTGTCGGATTACAAGGAGCGAGATGACGCGGATGACGAGGAGGAGATGCTCGATGGTGTGGCCGTGTGGGACTAC
GAGGGAGAGGGTGTCTCGTCTGAATTGGATGCTGGCCGTGATTCGGATGATGGTGATGAAGGTCCGGCTCGCGAT
GACGAGGGTAGCGAATCGGAGTCCAAATCACCACCTACTACCTCACGACGAAGCGGGAAATCCGCCCCTGCTAGA
TCCAAGGGCAGGGCAGTCGGGGGGGGGCAGAAGAAGCGGTCGCCGAGGCGTCACCAAGGACTCTTCTGA
Gene >Ophcf2|06476
ATGCCGCGTCGTCGCGCGCGTCGCCGGGAGCCGACCGAGGATGCGGAGGAGGACGACGAACAGGTTCACAATGAA
ACTGCCGGGCCTCGAACTTCTGGGGTAGATACGCAGCTCGCGCGGTTTGGCAGTTCGGGGCTGCGAAGTTTGCGC
TTCGACGAGGAGCTCTCGTGGAGGCCGGCCAAGCCTATTCCCAGCGCTACCCTCGTAGCCCGCCTCGAGAAGCTG
TCCAAGGAACTGGCCGACTTTGACCAGGGCGAGGTTGAGCTTGACTCTCTACGCGCTGTTGCAGGTCATCTCGCC
CATCGCAACCTGCTGCAGCACAAGGATCGCGGTGTTAAGGCGTACACGGCCTGCTGCCTGGTTGACATGCTCCGC
CTCTTCGTCCCGGACGCTCCCTTTACCGATGATCAGCTCAAGGCAAGGCTTTTTTTCTTTTCTTTTCTTTTCTTA
TTTCTCATGTTTTGACAGCGATACTGACCTGACTCACTTCAGATGATGTTTTCGCTCTTCGTCAAGGATATCCTG
CCGGCCCTGCACGACTCGACCAATCCGTACTACAGCCAGCATAAATACGTTCTCGTCTCCTTGACCGACGTCAAG
AGCATCCTGCTCATCTCTGATATCCATGGCGCCGATGATCTCATGTTGCGCCTATTCAACTCGGCCTTTGACGGC
GTCTCGGCCAGCGCCAAGGCCTCGACCGGCGAGCAGGTCGCACAAGACGTCGAGATCCTGCTGGGCGAGATGCTC
ATGGAGCTCATAGATGAGTCTCCTGGTAGTATTCCGGCCACGGTCATCGACGCCATCATCAGCCAATTCCTACGC
GCCGCACCGCCGGGCAGTGGCAGCGGCGGTCGTCACAAGGACGTCAGCGACAAGCAGTCGACGCTCCTCCGCAAG
ACAGAACCTCCCGCATACGTCATGGCCAAGAGCATCTGCAACAGCTGTGCCGACAAGATGTCGCGCTACGTGAGC
CAATACTTTAGCGACGTCATCCTCAACGCCTCGGGGTTTGCCACCAAGGCCAACAACTACCGTCAAGGCGACGAC
TCGGACGAAGAAGACGCCAATGCCGGCCCATCAGACGCGGATCTCAAGAGCCTCCGTCAGGCGCATCTGCTTATA
CGCGAGCTCTGGCGCGCCGCCCCCGAGATCCTACAAAACGTGGTACCTCAGCTGGACGCGGAGCTGTCTGCGGAC
AACGTCCACCTGCGACTGATAGCGACGGAAACGTTTGGCGACATGATTTCCGGCATCGGCGCCGCGGGTCCTCCG
CCGATGCCGACGCTCGATCCGACAGCATACCCGCAGCTGCGCCTGATGGACGAGACGCCTCCGCCAGAGCCTACC
GAAGTCAACGTACTGAAGAAGCCCTGCTCGCCGCAGTCGTTCGCCCAGACACACGCCGCGACGTACCGCAACTTC
ATCGGGCGCAAGAACGACAAGGCGGGTGCGATTCGAGCGGCTTGGGTCACAGCCGTGGGCTACATCGTCTCGACG
TCGGCCGGCGGCATCGGTCTCAGCCGTGAGGAGGAGAGCGAGCTCGTCAGGGGGCTCGGCGAGAAGCTCAACGAC
AGCGAGGAAAAGGTGCGACTCGCGGCTGTCAAGGCCATAGAGCTCTTTGGCTTCCGCGACGTCGTCTCCAAGCTG
GGCGTCGTCGGCGGCGTGGAAAAGGAGGGCTCCATCCTGGCCAGCCTCGCGGACCGCTGTCGCGACAGGAAGCCG
GCTGTACGCGTCGACGCCATGGTTCTCCTCGGGAAGCTGTGGGCGGTCGGTGCCGGTGAGATGGCTGACGGACAG
GATGCTGTCACGGCCTGTCTCTGGGGCGTGCCGTCGCGCATCATCAACGCCTTCTATGCCAACGATCCCGATCTC
AACATCCTGCTCGACAGGGTCATGTTCGAGTGCCTGGTTCCTCTCAAGTACCCGTCTATCAAGAAGTCGGCCAAG
TCGCAGACCAAGGGCGCTGCCGACCAGGACAGGATCCGGGCGGAGCGCATCCTGCTCATGCTCAAGTCGCTGGAC
GCGGCCGCGCAAAAGGCCTTCTTCGCCATGCAGGCGCGGCAGCCGCAGTTTGCCCAGGGCGTCGCCATCTTCATC
CAGCAGTGTGAGGCCTACAACGGGGGCGTCGTGGACGGTAACGAGGACAAGGTCAAGGCCAGCCTGGCCAAGACG
CTGCAGTGGCTCGGCACCTCGTTCCCCGATCCGCTCAAGGTGCGGTCTGATCTGCAGAAGTTTGCAAAGCTCAAC
GATCGCCGCAGCTACCAGCTGGTCAAGTACGCCATTGAGTCCGAGAGCGACTTCAAGACGGTCCGGAGGGCCATC
CACGAGCTCATCACTAAGATCCAGGCGGGATCGGCCTCGGGCTGTTTGGATACGCTGATTCCCCTGCTCTACCGG
TCCAGCTGCCTCATGTTCAACCGCAGCAACCTGGCGACCATCATGGACTACTCCAAGAGCGATAAGGACGGCTTC
GCCGCCGTTGCCCATCAAGTCCTCAACGACATCTCGCAGCGGAATCCCGACATCTTCAAGGCCCACGTCGGCGAG
CTGCACAGGGACATCACCGAGCAGGCGCCTACGGACAAGAGGACCAACGACCCGGCCGTGGCCGACATTCTCAAG
GCCTACTCGTCCTACTCGAAACGTTACCCGCGCGACATCGACTGCAGTAAAGCCTTCGTCCAGACGCTCGTCAAC
TACGCCCTCTACGGATCACCTCCCAAGTCTGGCAAGTACGCCGTCAACATCCTCCTCGCCAAGGACGACGATCGG
AGCAAGGTCACGGCCACGAACCTCTTGAGGAGCGCAGTCAAGGACCTGAACTACGGCACGCCGCATTTCCTTACC
AGACTGGCTACCGTCAGCCAGCTCGAGCGCCTCGCGCCCTCCGTCGCCGCCGACGAGGATGAAGTCATAGACGAT
CTGACCATCAACAAGATGCTGCGCCAAGTGCGGACCGCGGCCGAGCCAGATTCGGATCCCACCTGGGTTCATGAC
GTCGACATGGATCAGGAGCTCCAGGCCAAGTGTCTATCGCTGAGGATCCTCGTCAACCGAGCCATGGCCGCGGCC
GAGGAGCCGGACAGCGAAGAGCGGGTGAAGCCGGTCTTTAAGCTCCTCAGGACCCTCGTCGTCGCCGAGGGCGAG
TTTTGCAAGACGCAAGACACGCCGGCGCACCACAAGAAGCGGCTACGGCTACTGGCGGGCTTGTTGACACTGAAG
CTGTGCACGGTCAAGGCGTACGACGAGCAGCTGGAGCCGCTGAGCTTCAACAAGCTGGCCGAGCTCGTTCAGGAC
AGCGAGCTCCAGGTCCGACGGCGGTTCATGGAGAAGCTGCAGAACTACCTGACCCGAGGCAAGCTGCGGGCAAGA
TTCCACACCATCTTGTTCCTCGTCGCCTTTGAGCCCGTGACGGAGCTCAAGAGCAGGGTGGAAACGTGGATCCGG
TCTCGGGCTCGCTACTATGAAGAGAAGAAGCAGCAGATCATGGAGGCTATCATGGGCAGGCTGATTCCCCTCTTG
GCCCACCATCCGGACTATACCAGCCATGTCGACGATCTGGCTGACTTTGCCAACTACTTTCTCTTCTACTTGGGG
TCCGTCGCCACCGAGGGCAACATTTCTTTGATTTACAAGTACGCCGAGCGGGTCAAGCAGACGCGAGACGCTCTG
AGCCCCGACGGAAGCGACAACTTGTATGTGCTGAGCGATCTGGCGCAGACCATCATCCGGAAATACCAGGAGAGG
CGGAACTGGAGCTTCCAGGCCTGGCCGGGGAAGGTCGGGCTGCCCACGGGGCTCTACGTCGGCCTCCCTTCGAGC
GAGATGGCGCAGCAGATTGCCAAGAAGCAGTACATCCCGGATGAGCTGGACGAGAGGCTCGACGACCTGATGAGG
GCCATGGACCGCAAAAAGGTAAGCGAGATGTGAGACGGAAAGGGGAAAAAAAAAAGGGGGGGGGGGGGGGGGGCT
ATGCTGACGGTACAAGCAGAAACGAAAGTCGATGAACGACGCCAGCGAGCCGCCAGCCAAACGAACCAAGGGGCT
GGTCAAAACCACCACCAGGGATCGAACCGAGGCCAAGTCCAAGTCCGGTCCGAAGAAGGCCTCCAAGCCAAAGAC
GACGCCGCGAGCAAAGAAGGCATCGTCTCCGGCTGTTCCCGCGAGCGAGCGTCGACGGAGCAGTCGCGTTCACAA
GGTGTCGGATTACAAGGAGCGAGATGACGCGGATGACGAGGAGGAGATGCTCGATGGTGTGGCCGTGTGGGACTA
CGAGGGAGAGGGTGTCTCGTCTGAATTGGATGCTGGCCGTGATTCGGATGATGGTGATGAAGGTCCGGCTCGCGA
TGACGAGGGTAGCGAATCGGAGTCCAAATCACCACCTACTACCTCACGACGAAGCGGGAAATCCGCCCCTGCTAG
ATCCAAGGGCAGGGCAGTCGGGGGGGGGCAGAAGAAGCGGTCGCCGAGGCGTCACCAAGGACTCTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail